What is the catalog number for Recombinant Human Cathepsin O (CTSO)?

The catalog number for Recombinant Human Cathepsin O (CTSO) is CSB-BP006203HU.

What sizes are available for Recombinant Human Cathepsin O (CTSO)?

Recombinant Human Cathepsin O (CTSO) is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human Cathepsin O (CTSO) come in?

Recombinant Human Cathepsin O (CTSO) is available in 3 different pack sizes.

Is Recombinant Human Cathepsin O (CTSO) in stock?

Recombinant Human Cathepsin O (CTSO) is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures Recombinant Human Cathepsin O (CTSO)?

Recombinant Human Cathepsin O (CTSO) is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Human Cathepsin O (CTSO)?

Estimated delivery time for Recombinant Human Cathepsin O (CTSO) is approximately 15 business day(s), depending on your location.

Recombinant Human Cathepsin O (CTSO)

Product Specifications

Product Name Alternative

CTSO1

Abbreviation

Recombinant Human CTSO protein

Gene Name

CTSO

UniProt

P43234

Expression Region

108-321aa

Organism

Homo sapiens (Human)

Target Sequence

LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV

Tag

N-terminal MBP-tagged and C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Cell Biology

Relevance

Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover.

Molecular Weight

67.5 kDa

References & Citations

"First genome-wide association scan on neurophysiological endophenotypes points to trans-regulation effects on SLC2A3 in dyslexic children." Roeske D., Ludwig K.U., Neuhoff N., Becker J., Bartling J., Bruder J., Brockschmidt F.F., Warnke A., Remschmidt H., Hoffmann P., Muller-Myhsok B., Nothen M.M., Schulte-Korne G. Mol. Psychiatry 16:97-107 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.