Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Erythropoietin receptor/EpoR, Mouse (HEK293, His)

Erythropoietin receptor (EpoR) mediates erythropoietin-induced erythroblast proliferation and differentiation. After EPO stimulation, EpoR dimerizes, initiates the JAK2/STAT5 signaling cascade, and can activate STAT1, STAT3, and LYN tyrosine kinases in certain cell types. Erythropoietin receptor/EpoR Protein, Mouse (HEK293, His) is the recombinant mouse-derived Erythropoietin receptor/EpoR protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Erythropoietin receptor/EpoR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/erythropoietin-receptor-epor-protein-mouse-hek293-his.html

Purity

96.00

Smiles

APSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP

Molecular Formula

13857 (Gene_ID) P14753 (A25-P249) (Accession)

Molecular Weight

28-35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHI3L2 (NM_001025199) Human Over-expression Lysate
LC400404 20 µg

CHI3L2 (NM_001025199) Human Over-expression Lysate

Sign In for Pricing
View Details
FNIP1 Antibody: FITC
SPC-718D-FITC 100 µg

FNIP1 Antibody: FITC

Sign In for Pricing
View Details
Thymidylate Synthase (TMS715), Biotin conjugate, 0.1mg/mL
BNCB0715-100 1x 100 µL

Thymidylate Synthase (TMS715), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human DHX32 activation kit by CRISPRa
GA110946 1 Kit

Human DHX32 activation kit by CRISPRa

Sign In for Pricing
View Details
Pisum sativum Gel -PSA- Immobilized Lectin
A-2701-5 5 mL

Pisum sativum Gel -PSA- Immobilized Lectin

Sign In for Pricing
View Details
FLAP (ALOX5AP) (NM_001629) Human Over-expression Lysate
LC400611 20 µg

FLAP (ALOX5AP) (NM_001629) Human Over-expression Lysate

Sign In for Pricing
View Details