Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alkaline phosphatase, placental type (ALPP), partial

Product Specifications

Product Name Alternative

Alkaline phosphatase Regan isozyme Placental alkaline phosphatase 1 Short name: PLAP-1 PLAP

Abbreviation

Recombinant Human ALPP protein, partial

Gene Name

ALPP

UniProt

P05187

Expression Region

117-447aa

Organism

Homo sapiens (Human)

Target Sequence

TATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAV

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Tags & Cell Markers

Relevance

In most mammals there are four different isozymes: placental, placental-like, intestinal and tissue non-specific (liver/bone/kidney) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.9 kDa

References & Citations

"Nucleotide sequence of the human placental alkaline phosphatase gene. Evolution of the 5' flanking region by deletion/substitution." Knoll B.J., Rothblum K.N., Longley M.A. J. Biol. Chem. 263:12020-12027 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serpinb8 Mouse Gene Knockout Kit (CRISPR)
KN515594 1 Kit

Serpinb8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elastase 3A (CELA3A) (NM_005747) Human Over-expression Lysate
LY401752 100 µg

Elastase 3A (CELA3A) (NM_005747) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS520066 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
p-Aminophenyl Arsenoxide
TRC-A622500-5MG 5 mg

p-Aminophenyl Arsenoxide

Sign In for Pricing
View Details
PD1 / PDCD1 / CD279 (PDCD1/922), CF647 conjugate, 0.1mg/mL
BNC470922-100 1x 100 µL

PD1 / PDCD1 / CD279 (PDCD1/922), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mitochondria (Marker for Human Cells, Granular RCC's & Salivary Tumors) (MTC02/2860R), CF740 conjugate, 0.1mg/mL
BNC742860-100 1x 100 µL

Mitochondria (Marker for Human Cells, Granular RCC's & Salivary Tumors) (MTC02/2860R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details