Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pulmonary surfactant-associated protein B (SFTPB)

Product Specifications

Product Name Alternative

18 kDa pulmonary-surfactant protein 6 kDa protein Pulmonary surfactant-associated proteolipid SPL (Phe)

Abbreviation

Recombinant Human SFTPB protein

Gene Name

SFTPB

UniProt

P07988

Expression Region

201-279aa

Organism

Homo sapiens (Human)

Target Sequence

FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM

Tag

N-terminal MBP-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Cardiovascular

Relevance

Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.

Molecular Weight

50.7 kDa

References & Citations

"Use of human surfactant low molecular weight apoproteins in the reconstitution of surfactant biologic activity." Revak S.D., Merritt T.A., Degryse E., Stefani L., Courtney M., Hallman M., Cochrane C.G. J. Clin. Invest. 81:826-833 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Skin
CS633529 5x 5 µm

Frozen Tissue Sections, Skin

Sign In for Pricing
View Details
Stromal interaction molecule 1 (STIM1) (C-term) Rabbit Polyclonal Antibody
AP54072PU-N 400 µL

Stromal interaction molecule 1 (STIM1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WDR33 antibody
FNab09490 100 µg

WDR33 antibody

Sign In for Pricing
View Details
ZNF2 Mouse Monoclonal Antibody [Clone ID: OTI2B11]
CF810997 100 µg

ZNF2 Mouse Monoclonal Antibody [Clone ID: OTI2B11]

Sign In for Pricing
View Details
ARF6 Rabbit Monoclonal Antibody [Clone ID: 23GB3160]
TA424485S 20 µL

ARF6 Rabbit Monoclonal Antibody [Clone ID: 23GB3160]

Sign In for Pricing
View Details
Tmem160 (NM_026938) Mouse Tagged ORF Clone
MG201785 10 µg

Tmem160 (NM_026938) Mouse Tagged ORF Clone

Sign In for Pricing
View Details