Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin A11, Mouse (HEK293, His)

Serpin A11 protein is a member of the serpin family and is an important serine protease inhibitor that regulates proteolytic activity. Its study deepens our understanding of cellular processes related to proteolysis and has potential applications in therapy. Serpin A11 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpin A11 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Serpin A11 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpin-a11-protein-mouse-hek293-his.html

Purity

95.0

Smiles

QPFSAHGDKSLGASQPASHQSLEPAPAYHKVTPTITNFALRLYKQLAEEVAGNILFSPVSLSSSLALLSLGAHADTQTQILESLGFNLTETPAADVHRGFQSLLHTLDLPSPKLELKLGHSLFLDRQLKPQQRFLDSAKELYGALAFSANFTEAAATGQQINDLVRKQTYGQVVGCLPEFSHDTLMVLLNYIFFKAKWKHPFDRYQTRKQESFSLDQRTPLRIPMMRQKEMHRFLYDQEASCTVLQIEYSGTALLLLVLPDPGKMQQVEAALQPETLRRWGQRFLPSLLDLHLPRFSISATYNLEEILPLIGLGNLFDMEADLSGIMGQLNKTVSRVSHKAIVDMNEKGTEAAAASGLLSQPPALNMTSAPQAHYNRPFLLLLWEVTTQSLLFLGKVVNPAAG

Molecular Formula

380780 (Gene_ID) Q8CIE0 (Q22-G424) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calpain 5 (CAPN5) Human Over-expression Lysate
orb1366175 20 µg

Calpain 5 (CAPN5) Human Over-expression Lysate

Sign In for Pricing
View Details
Porcine Noradrenaline (NE) ELISA Kit-Sandwich
EK11F229-01 48 Test

Porcine Noradrenaline (NE) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Porcine Noradrenaline (NE) ELISA Kit-Sandwich
EK11F229-02 96 Tests

Porcine Noradrenaline (NE) ELISA Kit-Sandwich

Sign In for Pricing
View Details
OR1D4 3'UTR Luciferase Stable Cell Line
TU016293 1.0 mL

OR1D4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ICAM1 Antibody
MBS9435692-01 0.05 mL

ICAM1 Antibody

Sign In for Pricing
View Details
ICAM1 Antibody
MBS9435692-02 0.1 mL

ICAM1 Antibody

Sign In for Pricing
View Details