Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Prion-like protein doppel (Prnd)

Product Specifications

Product Name Alternative

Prnd; Prion-like protein doppel; Doppelganger; Dpl; PrPLP

Abbreviation

Recombinant Mouse Prnd protein

Gene Name

Prnd

UniProt

Q9QUG3

Expression Region

27-155aa

Organism

Mus musculus (Mouse)

Target Sequence

RGIKHRFKWNRKVLPSSGGQITEARVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKLHQRVLWRLIKEICSAKHCDFWLERG

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Neuroscience

Relevance

Doppelganger PrPLP

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Required for normal acrosome reaction and for normal male fertility

Molecular Weight

18.9 kDa

References & Citations

"Doppel is an N-glycosylated, glycosylphosphatidylinositol-anchored protein: expression in testis and ectopic production in the brains of Prnp (0/0) mice predisposed to Purkinje cell loss." Silverman G.L., Qin K., Moore R.C., Yang Y., Mastrangelo P., Tremblay P., Prusiner S.B., Cohen F.E., Westaway D. J. Biol. Chem. 275:26834-26841 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3295), CF568 conjugate, 0.1mg/mL
BNC683295-100 1x 100 µL

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3295), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OPC 4392 Hydrochloride Salt
TRC-O667500-10MG 10 mg

OPC 4392 Hydrochloride Salt

Sign In for Pricing
View Details
Human IL-18 Recombinant Rabbit monoclonal Antibody
HA750779 100 µL

Human IL-18 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
STK39 (NM_013233) Human Recombinant Protein
TP323981M 100 µg

STK39 (NM_013233) Human Recombinant Protein

Sign In for Pricing
View Details
FAM164B (ZC2HC1B) (NM_001013623) Human Over-expression Lysate
LY425352 100 µg

FAM164B (ZC2HC1B) (NM_001013623) Human Over-expression Lysate

Sign In for Pricing
View Details
Thymidylate Synthase (TS106 + TMS715), CF740 conjugate, 0.1mg/mL
BNC740716-100 1x 100 µL

Thymidylate Synthase (TS106 + TMS715), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details