Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Prion-like protein doppel (Prnd)

Product Specifications

Product Name Alternative

Prnd; Prion-like protein doppel; Doppelganger; Dpl; PrPLP

Abbreviation

Recombinant Mouse Prnd protein

Gene Name

Prnd

UniProt

Q9QUG3

Expression Region

27-155aa

Organism

Mus musculus (Mouse)

Target Sequence

RGIKHRFKWNRKVLPSSGGQITEARVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKLHQRVLWRLIKEICSAKHCDFWLERG

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Neuroscience

Relevance

Doppelganger PrPLP

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Required for normal acrosome reaction and for normal male fertility

Molecular Weight

18.9 kDa

References & Citations

"Doppel is an N-glycosylated, glycosylphosphatidylinositol-anchored protein: expression in testis and ectopic production in the brains of Prnp (0/0) mice predisposed to Purkinje cell loss." Silverman G.L., Qin K., Moore R.C., Yang Y., Mastrangelo P., Tremblay P., Prusiner S.B., Cohen F.E., Westaway D. J. Biol. Chem. 275:26834-26841 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Lptn/XCL1 Antibody Pair Set
E-KAB-0714 50 µL & 100 µg

Mouse Lptn/XCL1 Antibody Pair Set

Sign In for Pricing
View Details
OR52B4 (NM_001005161) Human Over-expression Lysate
LC423948 20 µg

OR52B4 (NM_001005161) Human Over-expression Lysate

Sign In for Pricing
View Details
AASDH Human Gene Knockout Kit (CRISPR)
KN416923 1 Kit

AASDH Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EIF4EBP2 (NM_004096) Human Over-expression Lysate
LY418216 100 µg

EIF4EBP2 (NM_004096) Human Over-expression Lysate

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2423), CF405S conjugate, 0.1mg/mL
BNC042423-100 1x 100 µL

BOB.1 (B-Cell Marker) (BOB1/2423), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR4P4 (C-term) Rabbit Polyclonal Antibody
AP53066PU-N 400 µL

OR4P4 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details