Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Interleukin-10 (IL10)

Product Specifications

Product Name Alternative

Cytokine synthesis inhibitory factor

Abbreviation

Recombinant Rhesus macaque IL10 protein

Gene Name

IL10

UniProt

P51496

Expression Region

19-178aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN

Tag

N-terminal 10xHis-tagged and C-terminal myc-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Immunology

Relevance

Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.

Molecular Weight

22.7 kDa

References & Citations

"Comparative sequence analysis of cytokine genes from human and nonhuman primates." Villinger F.J., Brar S.S., Mayne A.E., Chikkala N., Ansari A.A. J. Immunol. 155:3946-3954 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse CD1 Cerebral Cortex, posterior Total Protein
MT-211 0.1 mg

Mouse CD1 Cerebral Cortex, posterior Total Protein

Ask
View Details
P4HB Recombinant Antibody, PE Conjugated
bsm-62363R-PE-01 20 µL

P4HB Recombinant Antibody, PE Conjugated

Ask
View Details
P4HB Recombinant Antibody, PE Conjugated
bsm-62363R-PE-02 100 µL

P4HB Recombinant Antibody, PE Conjugated

Ask
View Details
Human OVOL2 activation kit by CRISPRa
GA111778 1 Kit

Human OVOL2 activation kit by CRISPRa

Ask
View Details
Human GPR146 Full Length Protein, His, Flag Tag (Detergent)
GP6-H51D3-20ug 20 µg

Human GPR146 Full Length Protein, His, Flag Tag (Detergent)

Ask
View Details
HEY 2 (Helix-loop-helix Transcription Factor, Hairy/enhancer-of-split related with YRPW motif 2, bHLHb32, BHLHB32, Cardiovascular helix-loop-helix factor 1, CHF1, Class B basic helix-loop-helix protein 32, GRIDLOCK, GRL, Hairy and enhancer of split-related protein 2, Hairy-related transcription factor 2, hCHF1, HERP, HERP1, HESR2, HESR-2, HES-related repressor protein 2, hHRT2, HRT2, HRT-2, MGC10720, Protein gridlock homolog (AP) discontinued
H2100-10-AP 100 µL

HEY 2 (Helix-loop-helix Transcription Factor, Hairy/enhancer-of-split related with YRPW motif 2, bHLHb32, BHLHB32, Cardiovascular helix-loop-helix factor 1, CHF1, Class B basic helix-loop-helix protein 32, GRIDLOCK, GRL, Hairy and enhancer of split-related protein 2, Hairy-related transcription factor 2, hCHF1, HERP, HERP1, HESR2, HESR-2, HES-related repressor protein 2, hHRT2, HRT2, HRT-2, MGC10720, Protein gridlock homolog (AP) discontinued

Ask
View Details