Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marmota monax Tumor necrosis factor (TNF), partial

Product Specifications

Product Name Alternative

Cachectin TNF-alpha Tumor necrosis factor ligand superfamily member 2

Abbreviation

Recombinant Marmota monax TNF protein, partial

Gene Name

TNF

UniProt

O35734

Expression Region

57-233aa

Organism

Marmota monax (Woodchuck)

Target Sequence

GPQREEFLNNLPLSPQAQMLTLRSSSQNMNDKPVAHVVAKNEDKEQLVWLSRRANALLANGMELIDNQLVVPANGLYLVYSQVLFKGQGCPSYVLLTHTVSRFAVSYQDKVNLLSAIKSPCPKESLEGAEFKPWYEPIYLGGVFELQKGDRLSAEVNLPSYLDFAESGQVYFGVIAL

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Immunology

Relevance

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.; FUNCTION

Molecular Weight

22.2 kDa

References & Citations

"Woodchuck lymphotoxin-alpha, -beta and tumor necrosis factor genes: structure, characterization and biological activity." Li D.H., Havell E.A., Brown C.L., Cullen J.M. Gene 242:295-305 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PE/Cyanine7 anti-human CD27
GT16003 25 Tests

PE/Cyanine7 anti-human CD27

Ask
View Details
Recombinant Macaca mulatta Melanocyte-stimulating hormone receptor (MC1R), partial
MBS7091174 Inquire

Recombinant Macaca mulatta Melanocyte-stimulating hormone receptor (MC1R), partial

Ask
View Details
C6orf186 (METTL24) (NM_001123364) Human Tagged Lenti ORF Clone
RC225557L4 10 µg

C6orf186 (METTL24) (NM_001123364) Human Tagged Lenti ORF Clone

Ask
View Details
Tubulin, alpha, acetylated (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1) (MaxLight 405) discontinued
T9154-10-ML405 100 µL

Tubulin, alpha, acetylated (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1) (MaxLight 405) discontinued

Ask
View Details
Recombinant Neurospora crassa Palmitoyltransferase AKR1 (akr-1), partial
MBS7087629 Inquire

Recombinant Neurospora crassa Palmitoyltransferase AKR1 (akr-1), partial

Ask
View Details
Rat beta-Naphthol ELISA Kit
MBS262949-01 48 Well

Rat beta-Naphthol ELISA Kit

Ask
View Details