Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Heat shock protein HSP 90-alpha (HSP90AA1), partial

Product Specifications

Product Name Alternative

HSP90AA1; HSP90A; HSPCAHeat shock protein HSP 90-alpha

Abbreviation

Recombinant Pig HSP90AA1 protein, partial

Gene Name

HSP90AA1

UniProt

O02705

Expression Region

222-367aa

Organism

Sus scrofa (Pig)

Target Sequence

VEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVR

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Signal Transduction

Relevance

Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function (By similarity) . Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity which is essential for its chaperone activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function. Engages with a range of client protein classes via its interaction with various co-chaperone proteins or complexes, that act as adapters, simultaneously able to interact with the specific client and the central chaperone itself. Recruitment of ATP and co-chaperone followed by client protein forms a functional chaperone. After the completion of the chaperoning process, properly folded client protein and co-chaperone leave HSP90 in an ADP-bound partially open conformation and finally, ADP is released from HSP90 which acquires an open conformation for the next cycle. Apart from its chaperone activity, it also plays a role in the regulation of the transcription machinery. HSP90 and its co-chaperones modulate transcription at least at three different levels. In the first place, they alter the steady-state levels of certain transcription factors in response to various physiological cues. Second, they modulate the activity of certain epigenetic modifiers, such as histone deacetylases or DNA methyl transferases, and thereby respond to the change in the environment. Third, they participate in the eviction of histones from the promoter region of certain genes and thereby turn on gene expression. Binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory response, including TNF secretion by monocytes. Interacts with HECTD1 (via N-terminus) (By similarity) .

Molecular Weight

19.7 kDa

References & Citations

"Molecular cloning and characterization of porcine cDNA encoding a 90-KDA heat shock protein and its expression following hyperthermia." Huang H.W., Lee W.C., Lin J.H., Jian S.C., Mao S.J., Yang P.C., Huang T.Y., Liu Y.C.Gene 226:307-315 (1999) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Bromosporine
TRC-B687500-5MG 5 mg

Bromosporine

Ask
View Details
pLV2-CMV-YTHDF1-PGK-Puro Plasmid
PVT46554 2 µg

pLV2-CMV-YTHDF1-PGK-Puro Plasmid

Ask
View Details
Rat Thyroid Hormone Responsive ELISA Kit
MBS070671-01 48 Well

Rat Thyroid Hormone Responsive ELISA Kit

Ask
View Details
Rat Thyroid Hormone Responsive ELISA Kit
MBS070671-02 96 Well

Rat Thyroid Hormone Responsive ELISA Kit

Ask
View Details
Rat Thyroid Hormone Responsive ELISA Kit
MBS070671-03 5x 96 Well

Rat Thyroid Hormone Responsive ELISA Kit

Ask
View Details
Rat Thyroid Hormone Responsive ELISA Kit
MBS070671-04 10x 96 Well

Rat Thyroid Hormone Responsive ELISA Kit

Ask
View Details