Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Recombinant Mouse Chitinase domain-containing protein 1 (Chid1)

Product Specifications

Product Name Alternative

Chid1Chitinase domain-containing protein 1

Abbreviation

Recombinant Mouse Chid1 protein

Gene Name

Chid1

UniProt

Q922Q9

Expression Region

20-393aa

Organism

Mus musculus (Mouse)

Target Sequence

TLSKSDAKKAASKMLLEKTQFSDKPVQDRGLVVTDIKAEDVVLEHRSYCSSRARERNFAGEVLGYVTPWNSHGYDVAKVFGSKFTQISPVWLQLKRRGREMFEITGLHDVDQGWMRAVKKHAKGVRIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVAQVAKNQHFDGFVVEVWSQLLSQKHVGLIHMLTHLAEALHQARLLVILVIPPAVTPGTDQLGMFTHKEFEQLAPILDGFSLMTYDYSTSQQPGPNAPLSWIRACVQVLDPKSQWRSKILLGLNFYGMDYAASKDAREPVIGARYVQTLKDHRPRVVWDSQAAEHFFEYKKNRGGRHVVFYPTLKSLQVRLELARELGVGVSIWELGQGLDYFYDLL

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Tags & Cell Markers

Relevance

Saccharide- and LPS-binding protein with possible roles in pathogen sensing and endotoxin neutralization. Ligand-binding specificity relates to the length of the oligosaccharides, with preference for chitotetraose (in vitro)

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Saccharide- and LPS-binding protein with possible roles in pathogen sensing and endotoxin neutralization. Ligand-binding specificity relates to the length of the oligosaccharides, with preference for chitotetraose (in vitro) (By similarity) .

Molecular Weight

44.7 kDa

References & Citations

"A tissue-specific atlas of mouse protein phosphorylation and expression."Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.Cell 143:1174-1189 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PSMG1 (Proteasome Assembly Chaperone 1, PAC-1, Chromosome 21 Leucine-rich Protein, C21-LRP, Down Syndrome Critical Region Protein 2, C21LRP, DSCR2, PAC1) APC
MBS6136310-01 0.1 mL

PSMG1 (Proteasome Assembly Chaperone 1, PAC-1, Chromosome 21 Leucine-rich Protein, C21-LRP, Down Syndrome Critical Region Protein 2, C21LRP, DSCR2, PAC1) APC

Ask
View Details
PSMG1 (Proteasome Assembly Chaperone 1, PAC-1, Chromosome 21 Leucine-rich Protein, C21-LRP, Down Syndrome Critical Region Protein 2, C21LRP, DSCR2, PAC1) APC
MBS6136310-02 5x 0.1 mL

PSMG1 (Proteasome Assembly Chaperone 1, PAC-1, Chromosome 21 Leucine-rich Protein, C21-LRP, Down Syndrome Critical Region Protein 2, C21LRP, DSCR2, PAC1) APC

Ask
View Details
TIAL1 Protein Lysate (Human) with C-Ha Tag
46687031 100 µg

TIAL1 Protein Lysate (Human) with C-Ha Tag

Ask
View Details
Lentiviral mouse Kl shRNA (UAS) - Lentiviral mouse Kl shRNA (UAS, iRFP) plasmid
GTR15290692 1 Vial

Lentiviral mouse Kl shRNA (UAS) - Lentiviral mouse Kl shRNA (UAS, iRFP) plasmid

Ask
View Details
One Step TUNEL Apoptosis Assay Kit (Red Fluorescence)
C1089 20 Tests

One Step TUNEL Apoptosis Assay Kit (Red Fluorescence)

Ask
View Details
Molindone hydrochloride 50mg
A17647-50 50 mg

Molindone hydrochloride 50mg

Ask
View Details