Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Recombinant Mouse Chitinase domain-containing protein 1 (Chid1)

Product Specifications

Product Name Alternative

Chid1Chitinase domain-containing protein 1

Abbreviation

Recombinant Mouse Chid1 protein

Gene Name

Chid1

UniProt

Q922Q9

Expression Region

20-393aa

Organism

Mus musculus (Mouse)

Target Sequence

TLSKSDAKKAASKMLLEKTQFSDKPVQDRGLVVTDIKAEDVVLEHRSYCSSRARERNFAGEVLGYVTPWNSHGYDVAKVFGSKFTQISPVWLQLKRRGREMFEITGLHDVDQGWMRAVKKHAKGVRIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVAQVAKNQHFDGFVVEVWSQLLSQKHVGLIHMLTHLAEALHQARLLVILVIPPAVTPGTDQLGMFTHKEFEQLAPILDGFSLMTYDYSTSQQPGPNAPLSWIRACVQVLDPKSQWRSKILLGLNFYGMDYAASKDAREPVIGARYVQTLKDHRPRVVWDSQAAEHFFEYKKNRGGRHVVFYPTLKSLQVRLELARELGVGVSIWELGQGLDYFYDLL

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Tags & Cell Markers

Relevance

Saccharide- and LPS-binding protein with possible roles in pathogen sensing and endotoxin neutralization. Ligand-binding specificity relates to the length of the oligosaccharides, with preference for chitotetraose (in vitro)

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Saccharide- and LPS-binding protein with possible roles in pathogen sensing and endotoxin neutralization. Ligand-binding specificity relates to the length of the oligosaccharides, with preference for chitotetraose (in vitro) (By similarity) .

Molecular Weight

44.7 kDa

References & Citations

"A tissue-specific atlas of mouse protein phosphorylation and expression."Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.Cell 143:1174-1189 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal Glutamate Receptor 6 Antibody [DyLight 594]
NBP2-98590DL594 0.1 mL

Rabbit Polyclonal Glutamate Receptor 6 Antibody [DyLight 594]

Ask
View Details
Lentiviral mouse Dnaja3 shRNA (UAS) - Lentiviral mouse Dnaja3 shRNA (UAS, iRFP) plasmid
GTR15113440 1 Vial

Lentiviral mouse Dnaja3 shRNA (UAS) - Lentiviral mouse Dnaja3 shRNA (UAS, iRFP) plasmid

Ask
View Details
HNF4a, phosphorylated (Ser304) (HNF-4-Alpha, Hepatocyte Nuclear Factor 4 Alpha, Hepatocyte Nuclear Factor 4-Alpha, HNF4a, HNF 4 Alpha, HNF4, HNF4, NR2a1, TCF14, HNF4, NR2A1, TCF14, HNF4A, HNF-4-Alpha, MODY1, NR2A1, TCF, TCF-14, Tcf4, Transcription Factor HNF 4, Transcription Factor HNF4, Transcription Factor HNF-4)
319349 100 µL

HNF4a, phosphorylated (Ser304) (HNF-4-Alpha, Hepatocyte Nuclear Factor 4 Alpha, Hepatocyte Nuclear Factor 4-Alpha, HNF4a, HNF 4 Alpha, HNF4, HNF4, NR2a1, TCF14, HNF4, NR2A1, TCF14, HNF4A, HNF-4-Alpha, MODY1, NR2A1, TCF, TCF-14, Tcf4, Transcription Factor HNF 4, Transcription Factor HNF4, Transcription Factor HNF-4)

Ask
View Details
Mouse Monoclonal SETD7/9 Antibody (s4E5) [DyLight 594]
NBP1-04298DL594 0.1 mL

Mouse Monoclonal SETD7/9 Antibody (s4E5) [DyLight 594]

Ask
View Details
HMGB1 Antibody, Biotin conjugated
A29999-100UG 100 µg

HMGB1 Antibody, Biotin conjugated

Ask
View Details
C15orf32 Human shRNA Plasmid Kit (Locus ID 145858)
TR306152 1 Kit

C15orf32 Human shRNA Plasmid Kit (Locus ID 145858)

Ask
View Details