Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine/threonine-protein kinase PAK 5 (PAK5), partial

Product Specifications

Product Name Alternative

P21-activated kinase 5 Short name: PAK-5 p21-activated kinase 7 Short name: PAK-7

Abbreviation

Recombinant Human PAK5 protein, partial

Gene Name

PAK5

UniProt

Q8TB93

Expression Region

1-293aa

Organism

Homo sapiens (Human)

Target Sequence

MFGKKKKKIEISGPSNFEHRVHTGFDAQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQ

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Cancer

Relevance

Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell migration, proliferation or cell survival. Activation by various effectors including growth factor receptors or active CDC42 and RAC1 results in a conformational change and a subsequent autophosphorylation on several serine and/or threonine residues. Phosphorylates the proto-oncogene RAF1 and stimulates its kinase activity. Promotes cell survival by phosphorylating the BCL2 antagonist of cell death BAD. Phosphorylates CTNND1, probably to regulate cytoskeletal organization and cell morphology. Keeps microtubules stable through MARK2 inhibition and destabilizes the F-actin network leading to the disappearance of stress fibers and focal adhesions.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.9 kDa

References & Citations

"p21-Activated kinase 5 (Pak5) localizes to mitochondria and inhibits apoptosis by phosphorylating BAD."Cotteret S., Jaffer Z.M., Beeser A., Chernoff J.Mol. Cell. Biol. 23:5526-5539 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Aminobiphenyl
TRC-A601808-1G 1 g

3-Aminobiphenyl

Sign In for Pricing
View Details
C9orf140 (SAPCD2) Human qPCR Primer Pair (NM_178448)
HP218806 200 Reactions

C9orf140 (SAPCD2) Human qPCR Primer Pair (NM_178448)

Sign In for Pricing
View Details
Lentiviral human CCDC91 shRNA (UAS) - Lentiviral human CCDC91 shRNA (UAS, iRFP) (100)
GTR15324234 1 Vial

Lentiviral human CCDC91 shRNA (UAS) - Lentiviral human CCDC91 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
PIK3R2 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-4160R-PE-Cy5.5 100 µL

PIK3R2 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Anti-PJA2 antibody
STJ28527 100 µl

Anti-PJA2 antibody

Sign In for Pricing
View Details
Lentiviral mouse Prlh shRNA (UAS) - Lentiviral mouse Prlh shRNA (UAS, GFP) plasmid
GTR15209974 1 Vial

Lentiviral mouse Prlh shRNA (UAS) - Lentiviral mouse Prlh shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details