Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine/threonine-protein kinase PAK 5 (PAK5), partial

Product Specifications

Product Name Alternative

P21-activated kinase 5 Short name: PAK-5 p21-activated kinase 7 Short name: PAK-7

Abbreviation

Recombinant Human PAK5 protein, partial

Gene Name

PAK5

UniProt

Q8TB93

Expression Region

1-293aa

Organism

Homo sapiens (Human)

Target Sequence

MFGKKKKKIEISGPSNFEHRVHTGFDAQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQ

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Cancer

Relevance

Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell migration, proliferation or cell survival. Activation by various effectors including growth factor receptors or active CDC42 and RAC1 results in a conformational change and a subsequent autophosphorylation on several serine and/or threonine residues. Phosphorylates the proto-oncogene RAF1 and stimulates its kinase activity. Promotes cell survival by phosphorylating the BCL2 antagonist of cell death BAD. Phosphorylates CTNND1, probably to regulate cytoskeletal organization and cell morphology. Keeps microtubules stable through MARK2 inhibition and destabilizes the F-actin network leading to the disappearance of stress fibers and focal adhesions.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.9 kDa

References & Citations

"p21-Activated kinase 5 (Pak5) localizes to mitochondria and inhibits apoptosis by phosphorylating BAD."Cotteret S., Jaffer Z.M., Beeser A., Chernoff J.Mol. Cell. Biol. 23:5526-5539 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nqo2 sgRNA CRISPR Lentivector set (Mouse)
K4549801 3x 1.0 µg

Nqo2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
PHKG2 (NM_000294) Human Recombinant Protein
TP762022 50 µg

PHKG2 (NM_000294) Human Recombinant Protein

Sign In for Pricing
View Details
Goat Osteopontin (OPN) ELISA Kit
YP-W75503-01 48 Tests

Goat Osteopontin (OPN) ELISA Kit

Sign In for Pricing
View Details
Goat Osteopontin (OPN) ELISA Kit
YP-W75503-02 96 Tests

Goat Osteopontin (OPN) ELISA Kit

Sign In for Pricing
View Details
Canine Interleukin 33 (IL-33) ELISA Kit
EIA05909Ca 1 Kit

Canine Interleukin 33 (IL-33) ELISA Kit

Sign In for Pricing
View Details
MLXIP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1309608 1.0 µg DNA

MLXIP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details