Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Macrophage migration inhibitory factor (Mif)

Product Specifications

Product Name Alternative

Delayed early response protein 6 (DER6) (Glycosylation-inhibiting factor) (GIF) (L-dopachrome isomerase) (L-dopachrome tautomerase (EC:5.3.3.12) ) (Phenylpyruvate tautomerase) (MIF)

Abbreviation

Recombinant Mouse Mif protein

Gene Name

Mif

UniProt

P34884

Expression Region

2-115aa

Organism

Mus musculus (Mouse)

Target Sequence

PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Immunology

Relevance

Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity, but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.9 kDa

References & Citations

"Molecular cloning and functional expression of a cDNA encoding glycosylation-inhibiting factor." Mikayama T., Nakano T., Gomi H., Nakagawa Y., Liu Y.C., Iwamatsu A., Weiser W.Y., Ishizaka K., Sato M., Ishii Y. Proc. Natl. Acad. Sci. U.S.A. 90:10056-10060 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Histone H3.3
MBS717134-01 0.01 mg

Recombinant Human Histone H3.3

Sign In for Pricing
View Details
Recombinant Human Histone H3.3
MBS717134-02 0.05 mg

Recombinant Human Histone H3.3

Sign In for Pricing
View Details
Recombinant Human Histone H3.3
MBS717134-03 0.1 mg

Recombinant Human Histone H3.3

Sign In for Pricing
View Details
Recombinant Human Histone H3.3
MBS717134-04 0.2 mg

Recombinant Human Histone H3.3

Sign In for Pricing
View Details
Recombinant Human Histone H3.3
MBS717134-05 0.5 mg

Recombinant Human Histone H3.3

Sign In for Pricing
View Details
Recombinant Human Histone H3.3
MBS717134-06 1 mg

Recombinant Human Histone H3.3

Sign In for Pricing
View Details