Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Odorant-binding protein

Product Specifications

Product Name Alternative

Odorant-binding protein; OBP

Abbreviation

Recombinant Pig Odorant-binding protein

UniProt

P81245

Expression Region

1-157aa

Organism

Sus scrofa (Pig)

Target Sequence

QEPQPEQDPFELSGKWITSYIGSSDLEKIGENAPFQVFMRSIEFDDKESKVYLNFFSKENGICEEFSLIGTKQEGNTYDVNYAGNNKFVVSYASETALIISNINVDEEGDKTIMTGLLGKGTDIEDQDLEKFKEVTRENGIPEENIVNIIERDDCPA

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

This protein is found in nasal epithelium and it binds a wide variety of chemical odorants.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.2 kDa

References & Citations

"Complexes of porcine odorant binding protein with odorant molecules belonging to different chemical classes." Vincent F., Spinelli S., Ramoni R., Grolli S., Pelosi P., Cambillau C., Tegoni M. J. Mol. Biol. 300:127-139 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRSP12 Protein Vector (Rat) (pPB-N-His)
PV273463 500 ng

HRSP12 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
CXCL10 Human Pre-designed siRNA Set A
HY-RS03384 1 Set

CXCL10 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Kcnq3 Rabbit Polyclonal Antibody
TA328950 50 µL

Kcnq3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Laminin subunit gamma-1 Polyclonal Conjugated Antibody
C42540 100 µL

Laminin subunit gamma-1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Human Collagen Type XI Alpha 1 (COL11A1) CLIA Kit
abx196549-01 96 Tests

Human Collagen Type XI Alpha 1 (COL11A1) CLIA Kit

Sign In for Pricing
View Details
Human Collagen Type XI Alpha 1 (COL11A1) CLIA Kit
abx196549-02 5x 96 Tests

Human Collagen Type XI Alpha 1 (COL11A1) CLIA Kit

Sign In for Pricing
View Details