Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus amyloliquefaciens Barstar

Product Specifications

Product Name Alternative

Ribonuclease inhibitor

Abbreviation

Recombinant Bacillus amyloliquefaciens Barstar protein

UniProt

P11540

Expression Region

2-90aa

Organism

Bacillus amyloliquefaciens (Bacillus velezensis)

Target Sequence

KKAVINGEQIRSISDLHQTLKKELALPEYYGENLDALWDCLTGWVEYPLVLEWRQFEQSKQLTENGAESVLQVFREAKAEGCDITIILS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Inhibitor of the ribonuclease barnase. Forms a one-to-one non-covalent complex.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.7 kDa

References & Citations

"Crystal structural analysis of protein-protein interactions drastically destabilized by a single mutation." Urakubo Y., Ikura T., Ito N. Protein Sci. 17:1055-1065 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ARHGEF3 (NM_001128615) AAV Particle
RC225955A1V 250 µL

Human ARHGEF3 (NM_001128615) AAV Particle

Sign In for Pricing
View Details
NADL2 rabbit pAb
ES11263-01 50 µL

NADL2 rabbit pAb

Sign In for Pricing
View Details
NADL2 rabbit pAb
ES11263-02 100 µL

NADL2 rabbit pAb

Sign In for Pricing
View Details
Human Dynein heavy chain 14, axonemal, DNAH14 ELISA KIT
ELI-32295h 96 Tests

Human Dynein heavy chain 14, axonemal, DNAH14 ELISA KIT

Sign In for Pricing
View Details
Wdr55 Rat shRNA Plasmid (Locus ID 307494)
TL702519 1 Kit

Wdr55 Rat shRNA Plasmid (Locus ID 307494)

Sign In for Pricing
View Details
Rabbit Monoclonal EphB4 Antibody (H1) [DyLight 405]
NBP2-89355V 0.1 mL

Rabbit Monoclonal EphB4 Antibody (H1) [DyLight 405]

Sign In for Pricing
View Details