Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Complement C5 (C5)

Product Specifications

Product Name Alternative

C5Complement C5 [Cleaved into: C5a anaphylatoxin]; Fragment

Abbreviation

Recombinant Rat C5 protein

Gene Name

C5

UniProt

P08650

Expression Region

1-77aa

Organism

Rattus norvegicus (Rat)

Target Sequence

DLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYETCEQRVARVTIGPHCIRAFNECCTIADKIRKESHHKGMLLGR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Derived from proteolytic degradation of complement C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chemokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.0 kDa

References & Citations

"Primary structure and functional characterization of rat C5a: an anaphylatoxin with unusually high potency." Cui L.-X., Carney D.F., Hugli T.E. Protein Sci. 3:1169-1177 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTSA Rabbit pAb
orb2709301-01 50 µL

CTSA Rabbit pAb

Sign In for Pricing
View Details
CTSA Rabbit pAb
orb2709301-02 100 µL

CTSA Rabbit pAb

Sign In for Pricing
View Details
PRMT1 Mouse Monoclonal Antibody
AG2195 50 µL

PRMT1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Polr3a 3'UTR Lenti-reporter-Luc Vector
37191084 1.0 µg

Polr3a 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PUB6/V5-His A
ELKP052 20 µL Plasmid

PUB6/V5-His A

Sign In for Pricing
View Details
Human Leukocyte antigen A ELISA Kit
MBS747795-01 48 Well

Human Leukocyte antigen A ELISA Kit

Sign In for Pricing
View Details