Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Complement C5 (C5)

Product Specifications

Product Name Alternative

C5Complement C5 [Cleaved into: C5a anaphylatoxin]; Fragment

Abbreviation

Recombinant Rat C5 protein

Gene Name

C5

UniProt

P08650

Expression Region

1-77aa

Organism

Rattus norvegicus (Rat)

Target Sequence

DLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYETCEQRVARVTIGPHCIRAFNECCTIADKIRKESHHKGMLLGR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Derived from proteolytic degradation of complement C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chemokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.0 kDa

References & Citations

"Primary structure and functional characterization of rat C5a: an anaphylatoxin with unusually high potency." Cui L.-X., Carney D.F., Hugli T.E. Protein Sci. 3:1169-1177 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRP3 AAV siRNA Pooled Vector
27609161 1.0 µg

LRP3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Potassium Voltage-Gated Channel Subfamily KQT Member 2 (KCNQ2) Antibody (PerCP)
abx444044 100 µg

Potassium Voltage-Gated Channel Subfamily KQT Member 2 (KCNQ2) Antibody (PerCP)

Sign In for Pricing
View Details
Procollagen C Proteinase Enhancer 2 (PCPE2) Recombinant, Human
156449-01 10 µg

Procollagen C Proteinase Enhancer 2 (PCPE2) Recombinant, Human

Sign In for Pricing
View Details
Procollagen C Proteinase Enhancer 2 (PCPE2) Recombinant, Human
156449-02 50 µg

Procollagen C Proteinase Enhancer 2 (PCPE2) Recombinant, Human

Sign In for Pricing
View Details
Procollagen C Proteinase Enhancer 2 (PCPE2) Recombinant, Human
156449-03 200 µg

Procollagen C Proteinase Enhancer 2 (PCPE2) Recombinant, Human

Sign In for Pricing
View Details
TREML2 Rabbit Polyclonal Antibody (HRP)
orb2112461 100 µL

TREML2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details