Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Dehydrin Xero 1 (XERO1)

Product Specifications

Product Name Alternative

DHNX

Abbreviation

Recombinant Mouse-ear cress XERO1 protein

Gene Name

XERO1

UniProt

P25863

Expression Region

1-128aa

Organism

Arabidopsis thaliana (Mouse-ear cress)

Target Sequence

MESYQNQSGAQQTHQQLDQFGNPFPATTGAYGTAGGAPAVAEGGGLSGMLHRSGSSSSSSSEDDGLGGRRRKKKGITEKIKEKLPGHHDSNKTSSLGSTTTAYDTGTVHHEKKGMMEKIKEKLPGGHH

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.1 kDa

References & Citations

"When defense pathways collide. The response of Arabidopsis to a combination of drought and heat stress." Rizhsky L., Liang H., Shuman J., Shulaev V., Davletova S., Mittler R. Plant Physiol. 134:1683-1696 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Citrobacter freundii Uncharacterized 12.5 kDa protein in dhaR-dhaT intergenic region
MBS1065239-01 0.02 mg (E-Coli)

Recombinant Citrobacter freundii Uncharacterized 12.5 kDa protein in dhaR-dhaT intergenic region

Sign In for Pricing
View Details
Recombinant Citrobacter freundii Uncharacterized 12.5 kDa protein in dhaR-dhaT intergenic region
MBS1065239-02 0.1 mg (E-Coli)

Recombinant Citrobacter freundii Uncharacterized 12.5 kDa protein in dhaR-dhaT intergenic region

Sign In for Pricing
View Details
Recombinant Citrobacter freundii Uncharacterized 12.5 kDa protein in dhaR-dhaT intergenic region
MBS1065239-03 0.02 mg (Yeast)

Recombinant Citrobacter freundii Uncharacterized 12.5 kDa protein in dhaR-dhaT intergenic region

Sign In for Pricing
View Details
Recombinant Citrobacter freundii Uncharacterized 12.5 kDa protein in dhaR-dhaT intergenic region
MBS1065239-04 0.1 mg (Yeast)

Recombinant Citrobacter freundii Uncharacterized 12.5 kDa protein in dhaR-dhaT intergenic region

Sign In for Pricing
View Details
Recombinant Citrobacter freundii Uncharacterized 12.5 kDa protein in dhaR-dhaT intergenic region
MBS1065239-05 0.02 mg (Baculovirus)

Recombinant Citrobacter freundii Uncharacterized 12.5 kDa protein in dhaR-dhaT intergenic region

Sign In for Pricing
View Details
Recombinant Citrobacter freundii Uncharacterized 12.5 kDa protein in dhaR-dhaT intergenic region
MBS1065239-06 1 mg (E-Coli)

Recombinant Citrobacter freundii Uncharacterized 12.5 kDa protein in dhaR-dhaT intergenic region

Sign In for Pricing
View Details