Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Dehydrin Xero 1 (XERO1)

Product Specifications

Product Name Alternative

DHNX

Abbreviation

Recombinant Mouse-ear cress XERO1 protein

Gene Name

XERO1

UniProt

P25863

Expression Region

1-128aa

Organism

Arabidopsis thaliana (Mouse-ear cress)

Target Sequence

MESYQNQSGAQQTHQQLDQFGNPFPATTGAYGTAGGAPAVAEGGGLSGMLHRSGSSSSSSSEDDGLGGRRRKKKGITEKIKEKLPGHHDSNKTSSLGSTTTAYDTGTVHHEKKGMMEKIKEKLPGGHH

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.1 kDa

References & Citations

"When defense pathways collide. The response of Arabidopsis to a combination of drought and heat stress." Rizhsky L., Liang H., Shuman J., Shulaev V., Davletova S., Mittler R. Plant Physiol. 134:1683-1696 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZSCAN16 (Zinc Finger and SCAN Domain-containing Protein 16, Zinc Finger Protein 392, ZNF392, Zinc Finger Protein 435, ZNF435, dJ265C24.3) (MaxLight 405) discontinued
135734-ML405 100 µL

ZSCAN16 (Zinc Finger and SCAN Domain-containing Protein 16, Zinc Finger Protein 392, ZNF392, Zinc Finger Protein 435, ZNF435, dJ265C24.3) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rabbit Olfactory receptor 2M2 (OR2M2) ELISA Kit
MBS7231638-01 48 Well

Rabbit Olfactory receptor 2M2 (OR2M2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Olfactory receptor 2M2 (OR2M2) ELISA Kit
MBS7231638-02 96 Well

Rabbit Olfactory receptor 2M2 (OR2M2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Olfactory receptor 2M2 (OR2M2) ELISA Kit
MBS7231638-03 5x 96 Well

Rabbit Olfactory receptor 2M2 (OR2M2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Olfactory receptor 2M2 (OR2M2) ELISA Kit
MBS7231638-04 10x 96 Well

Rabbit Olfactory receptor 2M2 (OR2M2) ELISA Kit

Sign In for Pricing
View Details
PLVX-Puro-SREB3
PPL01351-4a 1 Each

PLVX-Puro-SREB3

Sign In for Pricing
View Details