Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytotoxic T-lymphocyte protein 4 (CTLA4), partial

Product Specifications

Product Name Alternative

Cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4) (CD_antigen: CD152) (CD152)

Abbreviation

Recombinant Human CTLA4 protein, partial

Gene Name

CTLA4

UniProt

P16410

Expression Region

37-162aa

Organism

Homo sapiens (Human)

Target Sequence

AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.6 kDa

References & Citations

"Complete sequence determination of the mouse and human CTLA4 gene loci: cross-species DNA sequence similarity beyond exon borders." Ling V., Wu P.W., Finnerty H.F., Sharpe A.H., Gray G.S., Collins M. Genomics 60:341-355 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Herpes Simplex Virus 1 (HSV 1)
GWB-7E1F5B 1 mL

Herpes Simplex Virus 1 (HSV 1)

Sign In for Pricing
View Details
MLYCD Protein Vector (Mouse) (pPM-C-HA)
PV201196 500 ng

MLYCD Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
NRIP2, ID (NRIP2, Nuclear receptor-interacting protein 2) (MaxLight 650) discontinued
039150-ML650 100 µL

NRIP2, ID (NRIP2, Nuclear receptor-interacting protein 2) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Rat Rab5c Pre-designed siRNA Set B
SI211521B 1 Each

Rat Rab5c Pre-designed siRNA Set B

Sign In for Pricing
View Details
GSK4028 25mg
A21906-25 25 mg

GSK4028 25mg

Sign In for Pricing
View Details
4-Benzyloxy-3-chlorophenylboronic acid
430437-01 100 mg

4-Benzyloxy-3-chlorophenylboronic acid

Sign In for Pricing
View Details