Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apolipoprotein C-I (APOC1)

Product Specifications

Product Name Alternative

Apolipoprotein C1 (Apo-CI) (ApoC-I)

Abbreviation

Recombinant Human APOC1 protein

Gene Name

APOC1

UniProt

P02654

Expression Region

27-83aa

Organism

Homo sapiens (Human)

Target Sequence

TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Inhibitor of lipoprotein binding to the low density lipoprotein receptor, LDL receptor-related protein, and very low density lipoprotein receptor. Associates with high density lipoproteins and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein. Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.6 kDa

References & Citations

"Isolation and characterisation of a cDNA clone for human apolipoprotein CI and assignment of the gene to chromosome 19." Tata F., Henry I., Markham A.F., Wallis S.C., Weil D., Grzeschik K.H., Junien C., Williamson R., Humphries S.E. Hum. Genet. 69:345-349 (1985)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ramp3 (BC024765) Mouse Tagged ORF Clone
MG201003 10 µg

Ramp3 (BC024765) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Hpgds activation kit by CRISPRa
GA205721 1 Kit

Mouse Hpgds activation kit by CRISPRa

Sign In for Pricing
View Details
2-Phenanthrol-d9 (Major)
TRC-P295007-5MG 5 mg

2-Phenanthrol-d9 (Major)

Sign In for Pricing
View Details
Retinol Binding Protein-1 (RBP/872), CF740 conjugate, 0.1mg/mL
BNC740872-500 1x 500 µL

Retinol Binding Protein-1 (RBP/872), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant PLCG1 Antibody
RC-16400-01 50 μL

Recombinant PLCG1 Antibody

Sign In for Pricing
View Details
Recombinant PLCG1 Antibody
RC-16400-02 100 µL

Recombinant PLCG1 Antibody

Sign In for Pricing
View Details