Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Platelet-derived growth factor subunit B (PDGFB)

Product Specifications

Product Name Alternative

PDGF-2 (Platelet-derived growth factor B chain) (Platelet-derived growth factor beta polypeptide) (Proto-oncogene c-Sis) (INN: Becaplermin) (PDGF subunit B) (PDGF2) (SIS)

Abbreviation

Recombinant Human PDGFB protein

Gene Name

PDGFB

UniProt

P01127

Expression Region

82-190aa

Organism

Homo sapiens (Human)

Target Sequence

SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.3 kDa

References & Citations

"Oncogenic potential of the human platelet-derived growth factor transcriptional unit." Rao C.D., Igarashi H., Pech M.W., Robbins K.C., Aaronson S.A. Cold Spring Harb. Symp. Quant. Biol. 51:959-966 (1986)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Connexin 32/GJB1 Antibody Picoband® (Dylight550 Conjugate)
A01050-Dylight550 100 µg

Anti-Connexin 32/GJB1 Antibody Picoband® (Dylight550 Conjugate)

Sign In for Pricing
View Details
Human ATP5F1D Protein Lysate 20ug
IHUATP5F1DPLLY20UG 20 µg

Human ATP5F1D Protein Lysate 20ug

Sign In for Pricing
View Details
Chrymutasin B
HY-N14086 1 Each

Chrymutasin B

Sign In for Pricing
View Details
Rat Sh3bp5l Pre-designed siRNA Set B
SI212793B 1 Each

Rat Sh3bp5l Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Bacillus subtilis NTD biosynthesis operon regulator ntdR (ntdR)
MBS1031716-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis NTD biosynthesis operon regulator ntdR (ntdR)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis NTD biosynthesis operon regulator ntdR (ntdR)
MBS1031716-02 0.02 mg (Yeast)

Recombinant Bacillus subtilis NTD biosynthesis operon regulator ntdR (ntdR)

Sign In for Pricing
View Details