Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth/differentiation factor 15 (GDF15), partial

Product Specifications

Product Name Alternative

Macrophage inhibitory cytokine 1 (MIC-1) (NSAID-activated gene 1 protein) (NAG-1) (NSAID-regulated gene 1 protein) (NRG-1) (Placental TGF-beta) (Placental bone morphogenetic protein) (Prostate differentiation factor) (GDF-15)

Abbreviation

Recombinant Human GDF15 protein, partial

Gene Name

GDF15

UniProt

Q99988

Expression Region

197-308aa

Organism

Homo sapiens (Human)

Target Sequence

ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Regulates food intake, energy expenditure and body weight in response to metabolic and toxin-induced stresses. Binds to its receptor, GFRAL, and activates GFRAL-expressing neurons localized in the area postrema and nucleus tractus solitarius of the brainstem. It then triggers the activation of neurons localized within the parabrachial nucleus and central amygdala, which contitutes part of the 'emergency circuit' that shapes feeding responses to stressful conditions. On hepatocytes, inhibits growth hormone signaling.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.4 kDa

References & Citations

"Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S. Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gmeb1 (NM_001122992) Mouse Tagged ORF Clone
MG224569 10 µg

Gmeb1 (NM_001122992) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
AFP (h2) : 293T Lysate
sc-170237 100 µg - 200 µL

AFP (h2) : 293T Lysate

Sign In for Pricing
View Details
Anti-Zebrafish LIMS1 Antibody Picoband® APC Conjugated
AZA0A8M9QHP1-APC 100 µg/Vial

Anti-Zebrafish LIMS1 Antibody Picoband® APC Conjugated

Sign In for Pricing
View Details
HHIPL2
CSB-CL754409HU2 10 μg Plasmid + 200 μL Glycerol

HHIPL2

Sign In for Pricing
View Details
Fortunellin
BA4619-5 5 mg

Fortunellin

Sign In for Pricing
View Details
Rabbit Polyclonal FHL2 Antibody
NBP3-30885-100ug 100 µg

Rabbit Polyclonal FHL2 Antibody

Sign In for Pricing
View Details