Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella dysenteriae serotype 1 Shiga toxin subunit B (stxB)

Product Specifications

Product Name Alternative

StxB; SDY_1390; Shiga toxin subunit B

Abbreviation

Recombinant Shigella dysenteriae serotype 1 stxB protein

Gene Name

StxB

UniProt

Q32GM0

Expression Region

21-89aa

Organism

Shigella dysenteriae serotype 1 (strain Sd197)

Target Sequence

TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide in human intestinal microvilli.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.

Molecular Weight

15.1 kDa

References & Citations

"Genome dynamics and diversity of Shigella species, the etiologic agents of bacillary dysentery." Yang F., Yang J., Zhang X., Chen L., Jiang Y., Yan Y., Tang X., Wang J., Xiong Z., Dong J., Xue Y., Zhu Y., Xu X., Sun L., Chen S., Nie H., Peng J., Xu J. Jin Q. Nucleic Acids Res. 33:6445-6458 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Yersinia pseudotuberculosis Imidazole glycerol phosphate synthase subunit HisH (hisH)
MBS1426381-01 0.02 mg (E-Coli)

Recombinant Yersinia pseudotuberculosis Imidazole glycerol phosphate synthase subunit HisH (hisH)

Ask
View Details
Recombinant Yersinia pseudotuberculosis Imidazole glycerol phosphate synthase subunit HisH (hisH)
MBS1426381-02 0.1 mg (E-Coli)

Recombinant Yersinia pseudotuberculosis Imidazole glycerol phosphate synthase subunit HisH (hisH)

Ask
View Details
Recombinant Yersinia pseudotuberculosis Imidazole glycerol phosphate synthase subunit HisH (hisH)
MBS1426381-03 0.02 mg (Yeast)

Recombinant Yersinia pseudotuberculosis Imidazole glycerol phosphate synthase subunit HisH (hisH)

Ask
View Details
Recombinant Yersinia pseudotuberculosis Imidazole glycerol phosphate synthase subunit HisH (hisH)
MBS1426381-04 0.1 mg (Yeast)

Recombinant Yersinia pseudotuberculosis Imidazole glycerol phosphate synthase subunit HisH (hisH)

Ask
View Details
Recombinant Yersinia pseudotuberculosis Imidazole glycerol phosphate synthase subunit HisH (hisH)
MBS1426381-05 0.02 mg (Baculovirus)

Recombinant Yersinia pseudotuberculosis Imidazole glycerol phosphate synthase subunit HisH (hisH)

Ask
View Details
Recombinant Yersinia pseudotuberculosis Imidazole glycerol phosphate synthase subunit HisH (hisH)
MBS1426381-06 0.02 mg (Mammalian-Cell)

Recombinant Yersinia pseudotuberculosis Imidazole glycerol phosphate synthase subunit HisH (hisH)

Ask
View Details