Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin

Product Specifications

Product Name Alternative

RRNA N-glycosidase (Alpha-TCS)

Abbreviation

Recombinant Trichosanthes kirilowii rRNA N-glycosidase protein

UniProt

P09989

Expression Region

24-270aa

Organism

Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)

Target Sequence

DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Inactivates eukaryotic 60S ribosomal subunits.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Inactivates eukaryotic 60S ribosomal subunits.

Molecular Weight

33.1 kDa

References & Citations

"Isolation and DNA sequence of a gene encoding alpha-trichosanthin, a type I ribosome-inactivating protein." Chow T., Feldman R.A., Lovett M., Piatak M. J. Biol. Chem. 265:8670-8674 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal TNF RI/TNFRSF1A Antibody (001) [DyLight 755]
NBP2-89687IR 0.1 mL

Rabbit Monoclonal TNF RI/TNFRSF1A Antibody (001) [DyLight 755]

Sign In for Pricing
View Details
Polyclonal NR4A1 / NUR77 Antibody (N-Terminus)
APR01987G 0.05mg

Polyclonal NR4A1 / NUR77 Antibody (N-Terminus)

Sign In for Pricing
View Details
Paired Box Protein Pax-7 (PAX7) Antibody
abx028232-01 80 µL

Paired Box Protein Pax-7 (PAX7) Antibody

Sign In for Pricing
View Details
Paired Box Protein Pax-7 (PAX7) Antibody
abx028232-02 400 µL

Paired Box Protein Pax-7 (PAX7) Antibody

Sign In for Pricing
View Details
PLS1 (NM_001145319) Human 3' UTR Clone
SC215916 10 µg

PLS1 (NM_001145319) Human 3' UTR Clone

Sign In for Pricing
View Details
NTF6A Protein Vector (Human) (pPB-N-His)
PV105183 500 ng

NTF6A Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details