Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Serine protease 1 (Prss1)

Product Specifications

Product Name Alternative

Anionic trypsin I (Pretrypsinogen I) (Serine protease 1) (Try1)

Abbreviation

Recombinant Rat Prss1 protein

Gene Name

Prss1

UniProt

P00762

Expression Region

24-246aa

Organism

Rattus norvegicus (Rat)

Target Sequence

IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Metabolism

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.2 kDa

References & Citations

"Intra-acinar cell activation of trypsinogen during caerulein-induced pancreatitis in rats." Hofbauer B., Saluja A.K., Lerch M.M., Bhagat L., Bhatia M., Lee H.S., Frossard J.L., Adler G., Steer M.L. Am. J. Physiol. 275:G352-62 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOTCH4 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61337R-BF350-TR 20 µL

NOTCH4 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
VNN1 Rabbit pAb
E47R10314 100 µL

VNN1 Rabbit pAb

Sign In for Pricing
View Details
Escherichia Coli (E Coli) O157 Verotoxin 1 Antigen >90%
MBS569867-01 10 mg

Escherichia Coli (E Coli) O157 Verotoxin 1 Antigen >90%

Sign In for Pricing
View Details
Escherichia Coli (E Coli) O157 Verotoxin 1 Antigen >90%
MBS569867-02 5x 10 mg

Escherichia Coli (E Coli) O157 Verotoxin 1 Antigen >90%

Sign In for Pricing
View Details
Mouse Pklr activation kit by CRISPRa
GA203256 1 Kit

Mouse Pklr activation kit by CRISPRa

Sign In for Pricing
View Details
CD36; SCARB3 Protein (C-Fc, Mouse)
P514030 100 µg

CD36; SCARB3 Protein (C-Fc, Mouse)

Sign In for Pricing
View Details