Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Torpedo californica Acetylcholine receptor subunit alpha (CHRNA1), partial

Product Specifications

Product Name Alternative

CHRNA1Acetylcholine receptor subunit alpha

Abbreviation

Recombinant Tetronarce californica CHRNA1 protein, partial

Gene Name

CHRNA1

UniProt

P02710

Expression Region

25-234aa

Organism

Tetronarce californica (Pacific electric ray) (Torpedo californica)

Target Sequence

SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI

Tag

N-terminal 6xHis-sumostar-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Neuroscience

Relevance

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Molecular Weight

37.9 kDa

References & Citations

"NMR-based binding screen and structural analysis of the complex formed between alpha-cobratoxin and an 18-mer cognate peptide derived from the alpha 1 subunit of the nicotinic acetylcholine receptor from Torpedo californica." Zeng H., Hawrot E. J. Biol. Chem. 277:37439-37445 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL
BNC470745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
BNC470009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL
BNC400146-500 1x 500 µL

CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2 Microglobulin (B2M) (B2M/961), CF647 conjugate, 0.1mg/mL
BNC470961-100 1x 100 µL

Beta-2 Microglobulin (B2M) (B2M/961), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (GA-5 + ASTRO/789), CF594 conjugate, 0.1mg/mL
BNC940898-100 1x 100 µL

GFAP (GA-5 + ASTRO/789), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), CF568 conjugate, 0.1mg/mL
BNC680531-100 1x 100 µL

VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details