Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Phospholipase A-2-activating protein (Plaa), partial

Product Specifications

Product Name Alternative

PLA2P (PLAP) (Plap)

Abbreviation

Recombinant Mouse Plaa protein, partial

Gene Name

Plaa

UniProt

P27612

Expression Region

495-584aa

Organism

Mus musculus (Mouse)

Target Sequence

TGAGRYMPGSAGMDTTMTGVDPFTGNSAYRSAASKTVNIYFPKKEALTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLIC

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Plays a role in protein ubiquitination, sorting and degradation through its association with VCP. Involved in ubiquitin-mediated membrane proteins trafficking to late endosomes in an ESCRT-dependent manner, and hence plays a role in synaptic vesicle recycling. May play a role in macroautophagy, regulating for instance the clearance of damaged lysosomes. Plays a role in cerebellar Purkinje cell development. Positively regulates cytosolic and calcium-independent phospholipase A2 activities in a tumor necrosis factor alpha- or lipopolysaccharide-dependent manner, and hence prostaglandin E2 biosynthesis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a role in protein ubiquitination, sorting and degradation through its association with VCP (By similarity) . Involved in ubiquitin-mediated membrane proteins trafficking to late endosomes in an ESCRT-dependent manner, and hence plays a role in synaptic vesicle recycling

Molecular Weight

14.7 kDa

References & Citations

"Large-scale cDNA analysis reveals phased gene expression patterns during preimplantation mouse development." Ko M.S.H., Kitchen J.R., Wang X., Threat T.A., Wang X., Hasegawa A., Sun T., Grahovac M.J., Kargul G.J., Lim M.K., Cui Y., Sano Y., Tanaka T.S., Liang Y., Mason S., Paonessa P.D., Sauls A.D., DePalma G.E. Doi H. Development 127:1737-1749 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GPS1, ID (GPS1, COPS1, CSN1, COP9 signalosome complex subunit 1, G protein pathway suppressor 1, JAB1-containing signalosome subunit 1, Protein MFH) (APC)
MBS6304141-01 0.2 mL

GPS1, ID (GPS1, COPS1, CSN1, COP9 signalosome complex subunit 1, G protein pathway suppressor 1, JAB1-containing signalosome subunit 1, Protein MFH) (APC)

Ask
View Details
GPS1, ID (GPS1, COPS1, CSN1, COP9 signalosome complex subunit 1, G protein pathway suppressor 1, JAB1-containing signalosome subunit 1, Protein MFH) (APC)
MBS6304141-02 5x 0.2 mL

GPS1, ID (GPS1, COPS1, CSN1, COP9 signalosome complex subunit 1, G protein pathway suppressor 1, JAB1-containing signalosome subunit 1, Protein MFH) (APC)

Ask
View Details
FKBP1B Polyclonal Antibody
MBS8537596-01 0.1 mL

FKBP1B Polyclonal Antibody

Ask
View Details
FKBP1B Polyclonal Antibody
MBS8537596-02 0.1 mL (AF635)

FKBP1B Polyclonal Antibody

Ask
View Details
FKBP1B Polyclonal Antibody
MBS8537596-03 0.1 mL (AF610)

FKBP1B Polyclonal Antibody

Ask
View Details
FKBP1B Polyclonal Antibody
MBS8537596-04 0.1 mL (AF405S)

FKBP1B Polyclonal Antibody

Ask
View Details