Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat TGF-beta receptor type-2 (Tgfbr2), partial

Product Specifications

Product Name Alternative

TGF-beta type II receptor (Transforming growth factor-beta receptor type II) (TGF-beta receptor type II) (TbetaR-II) (TGFR-2)

Abbreviation

Recombinant Rat Tgfbr2 protein, partial

Gene Name

Tgfbr2

UniProt

P38438

Expression Region

24-166aa

Organism

Rattus norvegicus (Rat)

Target Sequence

IPPHVPKSVNSDLMAGDNSGAVKLPQLCKFCDVTLSTCDNQKSCMSNCSVTSICEKPQEVCVAVWRKNDKNITLETVCHDPKFTYHGFTLEDATSPTCVMKEKKRAGETFFMCSCNTEECNDYIIFNEEYTTSSPDLLLVIIQ

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Transmembrane serine/threonine kinase forming with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFRB1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Transmembrane serine/threonine kinase forming with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFRB1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways (By similarity) .

Molecular Weight

21.0 kDa

References & Citations

"TGF-beta receptor types I and II are differentially expressed during corneal epithelial wound repair." Zieske J.D., Hutcheon A.E., Guo X., Chung E.H., Joyce N.C. Invest. Ophthalmol. Vis. Sci. 42:1465-1471 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cadherin like 23 (CDH23) (NM_001171932) Human Tagged Lenti ORF Clone
RC230017L3 10 µg

Cadherin like 23 (CDH23) (NM_001171932) Human Tagged Lenti ORF Clone

Ask
View Details
Recombinant Brachypodium distachyon Photosystem II CP47 chlorophyll apoprotein (psbB), partial
MBS7066966 Inquire

Recombinant Brachypodium distachyon Photosystem II CP47 chlorophyll apoprotein (psbB), partial

Ask
View Details
Lentiviral mouse Cstf3 shRNA (UAS) - Lentiviral mouse Cstf3 shRNA (UAS) (100)
GTR15145026 1 Vial

Lentiviral mouse Cstf3 shRNA (UAS) - Lentiviral mouse Cstf3 shRNA (UAS) (100)

Ask
View Details
Tmco4 siRNA Oligos set (Mouse)
46830174 3x 5 nmol

Tmco4 siRNA Oligos set (Mouse)

Ask
View Details
Human Taste receptor type 2 member 14, TAS2R14 ELISA KIT
ELI-19059h 96 Tests

Human Taste receptor type 2 member 14, TAS2R14 ELISA KIT

Ask
View Details
RFWD2 Antibody
MBS7120558-01 0.05 mg

RFWD2 Antibody

Ask
View Details