Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage T4 Double-stranded DNA-binding protein (dsbA)

Product Specifications

Product Name Alternative

DsDNA-binding protein A (rpbB)

Abbreviation

Recombinant Enterobacteria phage T4 dsbA protein

Gene Name

DsbA

UniProt

P13320

Expression Region

1-89aa

Organism

Enterobacteria phage T4 (Bacteriophage T4)

Target Sequence

MAKKEMVEFDEAIHGEDLAKFIKEASDHKLKISGYNELIKDIRIRAKDELGVDGKMFNRLLALYHKDNRDVFEAETEEVVELYDTVFSK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

May play a role in transcription of several T4 genes. Binds double-stranded DNA and interacts preferentially with T4 late promoter regions.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May play a role in transcription of several T4 genes. Binds double-stranded DNA and interacts preferentially with T4 late promoter regions.

Molecular Weight

17.8 kDa

References & Citations

"Overexpression and structural characterization of the phage T4 protein DsbA." Sieber P., Lindemann A., Boehm M., Seidel G., Herzing U., van der Heusen P., Muller R., Ruger W., Jaenicke R., Rosch P. Biol. Chem. 379:51-58 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human THAP10 activation kit by CRISPRa
GA111259 1 Kit

Human THAP10 activation kit by CRISPRa

Sign In for Pricing
View Details
Urolithin M6
TRC-U847040-25MG 25 mg

Urolithin M6

Sign In for Pricing
View Details
Mouse 4930456L15Rik activation kit by CRISPRa
GA208878 1 Kit

Mouse 4930456L15Rik activation kit by CRISPRa

Sign In for Pricing
View Details
Synaptotagmin 3 (SYT3) (NM_001160329) Human Over-expression Lysate
LC431997 20 µg

Synaptotagmin 3 (SYT3) (NM_001160329) Human Over-expression Lysate

Sign In for Pricing
View Details
(±)-Bay K 8644
TRC-B119008-10MG 10 mg

(±)-Bay K 8644

Sign In for Pricing
View Details
LYPLAL1 (NM_138794) Human Recombinant Protein
TP304998M 100 µg

LYPLAL1 (NM_138794) Human Recombinant Protein

Sign In for Pricing
View Details