Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Bone morphogenetic protein 8B (Bmp8b)

Product Specifications

Product Name Alternative

BMP-8B

Abbreviation

Recombinant Mouse Bmp8b protein

Gene Name

Bmp8b

UniProt

P55105

Expression Region

261-399aa

Organism

Mus musculus (Mouse)

Target Sequence

TARPLKKKQLNQINQLPHSNKHLGILDDGHGSHGREVCRRHELYVSFRDLGWLDSVIAPQGYSAYYCAGECIYPLNSCMNSTNHATMQALVHLMKPDIIPKVCCVPTELSAISLLYYDRNNNVILRRERNMVVQACGCH

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis. Involved in the generation of primordial germ cells; this function involves Bmp4 in a synergistic manner though separate receptor complexes seem to be involved. Required for the initiation and maintenance of spermatogenesis. Signaling protein involved in regulation of thermogenesis and energy balance. Proposed to increase the peripheral response of brown adipose tissue to adrenergic stimulation while acting centrally in the hypothalamus to increase sympathetic output to BAT.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis (By similarity) . Involved in the generation of primordial germ cells; this function involves Bmp4 in a synergistic manner though separate receptor complexes seem to be involved. Required for the initiation and maintenance of spermatogenesis. Signaling protein involved in regulation of thermogenesis and energy balance. Proposed to increase the peripheral response of brown adipose tissue (BAT) to adrenergic stimulation while acting centrally in the hypothalamus to increase sympathetic output to BAT.

Molecular Weight

28.7 kDa

References & Citations

"Cooperation of endoderm-derived BMP2 and extraembryonic ectoderm-derived BMP4 in primordial germ cell generation in the mouse." Ying Y., Zhao G.Q. Dev. Biol. 232:484-492 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ddr2, CT (Ddr2, Ntrkr3, Tkt, Tyro10, Discoidin domain-containing receptor 2, CD167 antigen-like family member B, Neurotrophic tyrosine kinase, receptor-related 3, Receptor protein-tyrosine kinase TKT, Tyrosine-protein kinase TYRO10, CD167b) (MaxLight 750) discontinued
034539-ML750 100 µL

Ddr2, CT (Ddr2, Ntrkr3, Tkt, Tyro10, Discoidin domain-containing receptor 2, CD167 antigen-like family member B, Neurotrophic tyrosine kinase, receptor-related 3, Receptor protein-tyrosine kinase TKT, Tyrosine-protein kinase TYRO10, CD167b) (MaxLight 750) discontinued

Ask
View Details
Integrin beta 7 (ITGB7) (NM_000889) Human Tagged ORF Clone Lentiviral Particle
RC204193L4V 200 µL

Integrin beta 7 (ITGB7) (NM_000889) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
NCOA1 siRNA (Human)
MBS8207100-01 15 nmol

NCOA1 siRNA (Human)

Ask
View Details
NCOA1 siRNA (Human)
MBS8207100-02 30 nmol

NCOA1 siRNA (Human)

Ask
View Details
NCOA1 siRNA (Human)
MBS8207100-03 5x 30 nmol

NCOA1 siRNA (Human)

Ask
View Details
Recombinant Human PTH 15N Stable Isotope Protein
NBP2-35217-100ug 100 µg

Recombinant Human PTH 15N Stable Isotope Protein

Ask
View Details