Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Methylcytosine dioxygenase TET2 (Tet2), partial

Product Specifications

Product Name Alternative

Protein Ayu17-449 (Kiaa1546)

Abbreviation

Recombinant Mouse Tet2 protein, partial

Gene Name

Tet2

UniProt

Q4JK59

Expression Region

1810-1912aa

Organism

Mus musculus (Mouse)

Target Sequence

RISLVLYRHKNLFLPKHCLALWEAKMAEKARKEEECGKNGSDHVSQKNHGKQEKREPTGPQEPSYLRFIQSLAENTGSVTTDSTVTTSPYAFTQVTGPYNTFV

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Dioxygenase that catalyzes the conversion of the modified genomic base 5-methylcytosine into 5-hydroxymethylcytosine and plays a key role in active DNA demethylation. Has a preference for 5-hydroxymethylcytosine in CpG motifs. Also mediates subsequent conversion of 5hmC into 5-formylcytosine, and conversion of 5fC to 5-carboxylcytosine. Conversion of 5mC into 5hmC, 5fC and 5caC probably constitutes the first step in cytosine demethylation. Methylation at the C5 position of cytosine bases is an epigenetic modification of the mammalian genome which plays an important role in transcriptional regulation. In addition to its role in DNA demethylation, also involved in the recruitment of the O-GlcNAc transferase OGT to CpG-rich transcription start sites of active genes, thereby promoting histone H2B GlcNAcylation by OGT.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Dioxygenase that catalyzes the conversion of the modified genomic base 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC) and plays a key role in active DNA demethylation. Has a preference for 5-hydroxymethylcytosine in CpG motifs. Also mediates subsequent conversion of 5hmC into 5-formylcytosine (5fC), and conversion of 5fC to 5-carboxylcytosine (5caC) . Conversion of 5mC into 5hmC, 5fC and 5caC probably constitutes the first step in cytosine demethylation. Methylation at the C5 position of cytosine bases is an epigenetic modification of the mammalian genome which plays an important role in transcriptional regulation. In addition to its role in DNA demethylation, also involved in the recruitment of the O-GlcNAc transferase OGT to CpG-rich transcription start sites of active genes, thereby promoting histone H2B GlcNAcylation by OGT.

Molecular Weight

27.0 kDa

References & Citations

"Combined deficiency of tet1 and tet2 causes epigenetic abnormalities but is compatible with postnatal development." Dawlaty M.M., Breiling A., Le T., Raddatz G., Barrasa M.I., Cheng A.W., Gao Q., Powell B.E., Li Z., Xu M., Faull K.F., Lyko F., Jaenisch R. Dev. Cell 24:310-323 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ATHL1 (PGGHG) (NM_025092) Human Recombinant Protein
TP760917 50 µg

ATHL1 (PGGHG) (NM_025092) Human Recombinant Protein

Ask
View Details
Anti-Kisspeptin-1 Antibody
CQA4877-01 30 µL

Anti-Kisspeptin-1 Antibody

Ask
View Details
Anti-Kisspeptin-1 Antibody
CQA4877-02 50 μL

Anti-Kisspeptin-1 Antibody

Ask
View Details
Anti-Kisspeptin-1 Antibody
CQA4877-03 100 µL

Anti-Kisspeptin-1 Antibody

Ask
View Details
Anti-Kisspeptin-1 Antibody
CQA4877-04 200 µL

Anti-Kisspeptin-1 Antibody

Ask
View Details
PTCH1 Protein Lysate (Human) with C-Ha Tag
38062031 100 µg

PTCH1 Protein Lysate (Human) with C-Ha Tag

Ask
View Details