Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phytophthora cryptogea Beta-elicitin cryptogein

Product Specifications

Product Name Alternative

CRY

Abbreviation

Recombinant Phytophthora cryptogea Beta-elicitin cryptogein protein

UniProt

P15570

Expression Region

21-118aa

Organism

Phytophthora cryptogea

Target Sequence

TACTATQQTAAYKTLVSILSDASFNQCSTDSGYSMLTAKALPTTAQYKLMCASTACNTMIKKIVTLNPPNCDLTVPTSGLVLNVYSYANGFSNKCSSL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Induces local and distal defense responses in plants from the solanaceae and cruciferae families. Elicits leaf necrosis and causes the accumulation of pathogenesis-related proteins. Might interact with the lipidic molecules of the plasma membrane.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Induces local and distal defense responses (incompatible hypersensitive reaction) in plants from the solanaceae and cruciferae families. Elicits leaf necrosis and causes the accumulation of pathogenesis-related proteins. Might interact with the lipidic molecules of the plasma membrane.

Molecular Weight

17.3 kDa

References & Citations

"The 1.45 A resolution structure of the cryptogein-cholesterol complex: a close-up view of a sterol carrier protein (SCP) active site." Lascombe M.B., Ponchet M., Venard P., Milat M.L., Blein J.P., Prange T. Acta Crystallogr. D Biol. Crystallogr. 58:1442-1447 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plant Trans-2-Enoyl-CoA Reductase, Mitochondrial (MECR) ELISA Kit
MBS9378827 Inquire

Plant Trans-2-Enoyl-CoA Reductase, Mitochondrial (MECR) ELISA Kit

Sign In for Pricing
View Details
Canine ADP-ribosylation factor-like protein 2 (ARL2) ELISA Kit
MBS7216425-01 48 Well

Canine ADP-ribosylation factor-like protein 2 (ARL2) ELISA Kit

Sign In for Pricing
View Details
Canine ADP-ribosylation factor-like protein 2 (ARL2) ELISA Kit
MBS7216425-02 96 Well

Canine ADP-ribosylation factor-like protein 2 (ARL2) ELISA Kit

Sign In for Pricing
View Details
Canine ADP-ribosylation factor-like protein 2 (ARL2) ELISA Kit
MBS7216425-03 5x 96 Well

Canine ADP-ribosylation factor-like protein 2 (ARL2) ELISA Kit

Sign In for Pricing
View Details
Canine ADP-ribosylation factor-like protein 2 (ARL2) ELISA Kit
MBS7216425-04 10x 96 Well

Canine ADP-ribosylation factor-like protein 2 (ARL2) ELISA Kit

Sign In for Pricing
View Details
GFP/Luc Reporter Cell Line - Huh7
CSC-RR0483 One Frozen Vial

GFP/Luc Reporter Cell Line - Huh7

Sign In for Pricing
View Details