Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hemoglobin subunit gamma-1 (HBG1)

Product Specifications

Product Name Alternative

Gamma-1-globin (Hb F Agamma) (Hemoglobin gamma-1 chain) (Hemoglobin gamma-A chain)

Abbreviation

Recombinant Human HBG1 protein

Gene Name

HBG1

UniProt

P69891

Expression Region

2-147aa

Organism

Homo sapiens (Human)

Target Sequence

GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.

Molecular Weight

23.0 kDa

References & Citations

"Fetal hemoglobin levels and morbidity in untransfused patients with beta-thalassemia intermedia." Musallam K.M., Sankaran V.G., Cappellini M.D., Duca L., Nathan D.G., Taher A.T. Blood 119:364-367 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myelin Basic Protein (MBP) Rabbit Monoclonal Antibody
TA422879 100 µL

Myelin Basic Protein (MBP) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human NHSL2 activation kit by CRISPRa
GA117484 1 Kit

Human NHSL2 activation kit by CRISPRa

Sign In for Pricing
View Details
(1R,5S,6R)-Ethyl 5-(Pentan-3-yloxy)-7-oxabicyclo[4.1.0]hept-3-ene-3-carboxylate
TRC-E917990-25MG 25 mg

(1R,5S,6R)-Ethyl 5-(Pentan-3-yloxy)-7-oxabicyclo[4.1.0]hept-3-ene-3-carboxylate

Sign In for Pricing
View Details
CDX1 (NM_001804) Human Over-expression Lysate
LY419740 100 µg

CDX1 (NM_001804) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human E-Selectin/SELE Protein (His Tag)
PKSH032403-01 10 µg

Recombinant Human E-Selectin/SELE Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human E-Selectin/SELE Protein (His Tag)
PKSH032403-02 50 µg

Recombinant Human E-Selectin/SELE Protein (His Tag)

Sign In for Pricing
View Details