Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apolipoprotein B-100 (APOB), partial

Product Specifications

Product Name Alternative

Apo B-100 (Apo B-48)

Abbreviation

Recombinant Human APOB protein, partial

Gene Name

APOB

UniProt

P04114

Expression Region

28-127aa

Organism

Homo sapiens (Human)

Target Sequence

EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100) . Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100) . Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.

Molecular Weight

14.7 kDa

References & Citations

"Molecular cloning of human LDL apolipoprotein B cDNA. Evidence for more than one gene per haploid genome." Shoulders C.C., Myant N.B., Sidoli A., Rodriguez J.C., Cortese C., Baralle F.E., Cortese R. Atherosclerosis 58:277-289 (1985)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF223 Antibody, Biotin conjugated
A38801-50UG 50 µg

ZNF223 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ZNFX1 siRNA (Mouse)
orb1838870-01 15 nmol

ZNFX1 siRNA (Mouse)

Sign In for Pricing
View Details
ZNFX1 siRNA (Mouse)
orb1838870-02 30 nmol

ZNFX1 siRNA (Mouse)

Sign In for Pricing
View Details
OR1L8 Human Gene Knockout Kit (CRISPR)
KN424016 1 Kit

OR1L8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human SOCS-3 Recombinant Protein
PROTO14543-10ug 10 µg

Human SOCS-3 Recombinant Protein

Sign In for Pricing
View Details
RPL27 antibody
FNab07426 100 µg

RPL27 antibody

Sign In for Pricing
View Details