Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Actin-like protein 8 (ACTL8)

Product Specifications

Product Name Alternative

Cancer/testis antigen 57 (CT57)

Abbreviation

Recombinant Human ACTL8 protein

Gene Name

ACTL8

UniProt

Q9H568

Expression Region

1-366aa

Organism

Homo sapiens (Human)

Target Sequence

MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.9 kDa

References & Citations

"A human interactome in three quantitative dimensions organized by stoichiometries and abundances." Hein M.Y., Hubner N.C., Poser I., Cox J., Nagaraj N., Toyoda Y., Gak I.A., Weisswange I., Mansfeld J., Buchholz F., Hyman A.A., Mann M. Cell 163:712-723 (2015)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kisspeptin-13 (4-13) (human)
orb2692723-01 5 mg

Kisspeptin-13 (4-13) (human)

Sign In for Pricing
View Details
Kisspeptin-13 (4-13) (human)
orb2692723-02 10 mg

Kisspeptin-13 (4-13) (human)

Sign In for Pricing
View Details
Recombinant Mycobacterium Leprae gmk Protein (aa 1-210)
VAng-Yyj1717-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Leprae gmk Protein (aa 1-210)

Sign In for Pricing
View Details
DSPP ELISA Kit (Rat) (OKEH06046)
OKEH06046 96 Well

DSPP ELISA Kit (Rat) (OKEH06046)

Sign In for Pricing
View Details
Ethyl 1H-pyrazole-4-carboxylate
OR13194-01 5 g

Ethyl 1H-pyrazole-4-carboxylate

Sign In for Pricing
View Details
Ethyl 1H-pyrazole-4-carboxylate
OR13194-02 25 g

Ethyl 1H-pyrazole-4-carboxylate

Sign In for Pricing
View Details