Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schistosoma japonicum Glutathione S-transferase class-mu 26 kDa isozyme

Product Specifications

Product Name Alternative

Sj26 antigen (SjGST) (GST 26)

Abbreviation

Recombinant Schistosoma japonicum GST 26 protein

UniProt

P08515

Expression Region

2-218aa

Organism

Schistosoma japonicum (Blood fluke)

Target Sequence

SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.GST isoenzymes appear to play a central role in the parasite detoxification system. Other functions are also suspected including a role in increasing the solubility of haematin in the parasite gut.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.; FUNCTION

Molecular Weight

30.4 kDa

References & Citations

"Insights into dynein motor domain function from a 3.3-A crystal structure." Schmidt H., Gleave E.S., Carter A.P. Nat. Struct. Mol. Biol. 19:492-497 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcdhb7 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3123804 1.0 µg DNA

Pcdhb7 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Lentiviral human ERAP1 shRNA (UAS) - Lentiviral human ERAP1 shRNA (UAS, RFP) (25)
GTR15108551 1 Vial

Lentiviral human ERAP1 shRNA (UAS) - Lentiviral human ERAP1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
CACNG7 3'UTR GFP Stable Cell Line
TU053378 1.0 mL

CACNG7 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
GAL3ST1 Antibody
MBS5311957-01 0.1 mL

GAL3ST1 Antibody

Sign In for Pricing
View Details
GAL3ST1 Antibody
MBS5311957-02 5x 0.1 mL

GAL3ST1 Antibody

Sign In for Pricing
View Details
Phospho-RPS6KA5 (S360) Antibody
A42446-50UG 50 µg

Phospho-RPS6KA5 (S360) Antibody

Sign In for Pricing
View Details