Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hemoglobin subunit gamma-2 (HBG2)

Product Specifications

Product Name Alternative

Gamma-2-globin (Hb F Ggamma) (Hemoglobin gamma-2 chain) (Hemoglobin gamma-G chain)

Abbreviation

Recombinant Human HBG2 protein

Gene Name

HBG2

UniProt

P69892

Expression Region

2-147aa

Organism

Homo sapiens (Human)

Target Sequence

GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.

Molecular Weight

23.0 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ." The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL-1R1 Antibody (4O465)
TMAH-00618-01 50 μL

Anti-IL-1R1 Antibody (4O465)

Sign In for Pricing
View Details
Anti-IL-1R1 Antibody (4O465)
TMAH-00618-02 100 µL

Anti-IL-1R1 Antibody (4O465)

Sign In for Pricing
View Details
Rat Apolipoprotein E (APOE) ELISA Kit
abx256331-01 96 Tests

Rat Apolipoprotein E (APOE) ELISA Kit

Sign In for Pricing
View Details
Rat Apolipoprotein E (APOE) ELISA Kit
abx256331-02 5x 96 Tests

Rat Apolipoprotein E (APOE) ELISA Kit

Sign In for Pricing
View Details
Rat Apolipoprotein E (APOE) ELISA Kit
abx256331-03 10x 96 Tests

Rat Apolipoprotein E (APOE) ELISA Kit

Sign In for Pricing
View Details
ODAPH (NM_178497) Human Over-expression Lysate
LH15636V 100 µg

ODAPH (NM_178497) Human Over-expression Lysate

Sign In for Pricing
View Details