What is the catalog number for Recombinant Human Hemoglobin subunit gamma-2 (HBG2)?

The catalog number for Recombinant Human Hemoglobin subunit gamma-2 (HBG2) is CSB-EP010156HU.

What sizes are available for Recombinant Human Hemoglobin subunit gamma-2 (HBG2)?

Recombinant Human Hemoglobin subunit gamma-2 (HBG2) is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human Hemoglobin subunit gamma-2 (HBG2) come in?

Recombinant Human Hemoglobin subunit gamma-2 (HBG2) is available in 3 different pack sizes.

Is Recombinant Human Hemoglobin subunit gamma-2 (HBG2) in stock?

Recombinant Human Hemoglobin subunit gamma-2 (HBG2) is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures Recombinant Human Hemoglobin subunit gamma-2 (HBG2)?

Recombinant Human Hemoglobin subunit gamma-2 (HBG2) is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Human Hemoglobin subunit gamma-2 (HBG2)?

Estimated delivery time for Recombinant Human Hemoglobin subunit gamma-2 (HBG2) is approximately 15 business day(s), depending on your location.

Recombinant Human Hemoglobin subunit gamma-2 (HBG2)

Product Specifications

Product Name Alternative

Gamma-2-globin (Hb F Ggamma) (Hemoglobin gamma-2 chain) (Hemoglobin gamma-G chain)

Abbreviation

Recombinant Human HBG2 protein

Gene Name

HBG2

UniProt

P69892

Expression Region

2-147aa

Organism

Homo sapiens (Human)

Target Sequence

GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.

Molecular Weight

23.0 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ." The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.