Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial

Product Specifications

Product Name Alternative

GP-C

Abbreviation

Recombinant Lassa virus GPC protein, partial

Gene Name

GPC

UniProt

P08669

Expression Region

59-259aa

Organism

Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV)

Target Sequence

TSLYKGVYELQTLELNMETLNMTMPLSCTKNNSHHYIMVGNETGLELTLTNTSIINHKFCNLSDAHKKNLYDHALMSIISTFHLSIPNFNQYEAMSCDFNGGKISVQYNLSHSYAGDAANHCGTVANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWEDHCQFSRPSPIGYLGLLSQRTRDIYISRRLL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Glycoprotein G1: interacts with the host receptor. Mediates virus attachment to host receptor alpha-dystroglycan DAG1. This attachment induces virion internalization predominantly through clathrin- and caveolin-independent endocytosis.Glycoprotein G2: class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome.Stable signal peptide: cleaved and functions as a signal peptide. In addition, it is also retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Stable signal peptide (SSP) is cleaved but is apparently retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational cleavage of GP1 and GP2, glycoprotein transport to the cell plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion. The GP complex interacts with host glycosylated LAMP1 to mediate efficient infection.

Molecular Weight

27.8 kDa

References & Citations

"Maturation cleavage within the ectodomain of Lassa virus glycoprotein relies on stabilization by the cytoplasmic tail." Schlie K., Strecker T., Garten W. FEBS Lett. 584:4379-4382 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COL1A1 Rabbit Polyclonal Antibody (Biotin)
orb2097904 100 µL

COL1A1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Mouse Nucleosome assembly protein 1-like 4, NAP1L4 ELISA Kit
MBS9325911-01 48 Well

Mouse Nucleosome assembly protein 1-like 4, NAP1L4 ELISA Kit

Sign In for Pricing
View Details
Mouse Nucleosome assembly protein 1-like 4, NAP1L4 ELISA Kit
MBS9325911-02 96 Well

Mouse Nucleosome assembly protein 1-like 4, NAP1L4 ELISA Kit

Sign In for Pricing
View Details
Mouse Nucleosome assembly protein 1-like 4, NAP1L4 ELISA Kit
MBS9325911-03 5x 96 Well

Mouse Nucleosome assembly protein 1-like 4, NAP1L4 ELISA Kit

Sign In for Pricing
View Details
Mouse Nucleosome assembly protein 1-like 4, NAP1L4 ELISA Kit
MBS9325911-04 10x 96 Well

Mouse Nucleosome assembly protein 1-like 4, NAP1L4 ELISA Kit

Sign In for Pricing
View Details
MDM2 Antibody
orb1177782 100 µg

MDM2 Antibody

Sign In for Pricing
View Details