Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium acetobutylicum Butyrate--acetoacetate CoA-transferase subunit B (ctfB)

Product Specifications

Product Name Alternative

Acetoacetyl-CoA:acetate/butyrate CoA-transferase subunit B (Coat B)

Abbreviation

Recombinant Clostridium acetobutylicum ctfB protein

Gene Name

CtfB

UniProt

P23673

Expression Region

1-221aa

Organism

Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

Target Sequence

MINDKNLAKEIIAKRVARELKNGQLVNLGVGLPTMVADYIPKNFKITFQSENGIVGMGASPKINEADKDVVNAGGDYTTVLPDGTFFDSSVSFSLIRGGHVDVTVLGALQVDEKGNIANWIVPGKMLSGMGGAMDLVNGAKKVIIAMRHTNKGQPKILKKCTLPLTAKSQANLIVTELGVIEVINDGLLLTEINKNTTIDEIRSLTAADLLISNELRPMAV

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Involved in solventogenic switch which allows C.acetobutylicum to uptake acid and produce solvents. Acts mainly to detoxify the medium by removing the acetate and butyrate excreted earlier in the fermentation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in solventogenic switch which allows C.acetobutylicum to uptake acid and produce solvents. Acts mainly to detoxify the medium by removing the acetate and butyrate excreted earlier in the fermentation.

Molecular Weight

30.6 kDa

References & Citations

"Cloning and expression of Clostridium acetobutylicum ATCC 824 acetoacetyl-coenzyme A:acetate/butyrate:coenzyme A-transferase in Escherichia coli." Cary J.W., Petersen D.J., Papoutsakis E.T., Bennett G.N. Appl. Environ. Microbiol. 56:1576-1583 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 17 shRNA (h) Lentiviral Particles
sc-44612-V 200 µL

Mucin 17 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Monoclonal RBP4 Antibody (aa19-201, clone AT2B4), Clone: AT2B4
AMR09704G 0.05ml

Monoclonal RBP4 Antibody (aa19-201, clone AT2B4), Clone: AT2B4

Sign In for Pricing
View Details
RPL35AP31 ORF Vector (Human) (pORF)
ORF030685 1.0 µg DNA

RPL35AP31 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Human VEGF 145 (aa 27-171)
7626-VE-010 10 µg

Recombinant Human VEGF 145 (aa 27-171)

Sign In for Pricing
View Details
Olr1486 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV635890 1.0 µg DNA

Olr1486 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
RPL13A CRISPR All-in-one AAV vector set (with saCas9)(Rat)
40804156 3x 1.0 µg DNA

RPL13A CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details