What sizes are available for Recombinant Shigella flexneri Glutaredoxin-4 (grxD)?

Recombinant Shigella flexneri Glutaredoxin-4 (grxD) is available in the following size(s): 10 µg, 50 µg, 200 µg, 500 µg, 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Shigella flexneri Glutaredoxin-4 (grxD) come in?

Recombinant Shigella flexneri Glutaredoxin-4 (grxD) is available in 7 different pack sizes.

Who manufactures Recombinant Shigella flexneri Glutaredoxin-4 (grxD)?

Recombinant Shigella flexneri Glutaredoxin-4 (grxD) is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Shigella flexneri Glutaredoxin-4 (grxD)?

Estimated delivery time for Recombinant Shigella flexneri Glutaredoxin-4 (grxD) is approximately 15 business day(s), depending on your location.

Recombinant Shigella flexneri Glutaredoxin-4 (grxD)

Q: What is the catalog number for Recombinant Shigella flexneri Glutaredoxin-4 (grxD)?

The catalog number for Recombinant Shigella flexneri Glutaredoxin-4 (grxD) is CSB-EP364758SZB.

Q: Is Recombinant Shigella flexneri Glutaredoxin-4 (grxD) in stock?

Recombinant Shigella flexneri Glutaredoxin-4 (grxD) is currently made to order / not held in immediate stock. Contact us for lead time.

Product Specifications

Product Name Alternative

Monothiol glutaredoxin (ydhD) (Grx4)

Abbreviation

Recombinant Shigella flexneri grxD protein

Gene Name

GrxD

UniProt

P0AC72

Expression Region

1-115aa

Organism

Shigella flexneri

Target Sequence

MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYKSEEPDAE

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters.

Molecular Weight

28.9 kDa

References & Citations

"Complete genome sequence and comparative genomics of Shigella flexneri serotype 2a strain 2457T." Wei J., Goldberg M.B., Burland V., Venkatesan M.M., Deng W., Fournier G., Mayhew G.F., Plunkett G. III, Rose D.J., Darling A., Mau B., Perna N.T., Payne S.M., Runyen-Janecky L.J., Zhou S., Schwartz D.C., Blattner F.R. Infect. Immun. 71:2775-2786 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.