Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri Glutaredoxin-4 (grxD)

Product Specifications

Product Name Alternative

Monothiol glutaredoxin (ydhD) (Grx4)

Abbreviation

Recombinant Shigella flexneri grxD protein

Gene Name

GrxD

UniProt

P0AC72

Expression Region

1-115aa

Organism

Shigella flexneri

Target Sequence

MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYKSEEPDAE

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters.

Molecular Weight

28.9 kDa

References & Citations

"Complete genome sequence and comparative genomics of Shigella flexneri serotype 2a strain 2457T." Wei J., Goldberg M.B., Burland V., Venkatesan M.M., Deng W., Fournier G., Mayhew G.F., Plunkett G. III, Rose D.J., Darling A., Mau B., Perna N.T., Payne S.M., Runyen-Janecky L.J., Zhou S., Schwartz D.C., Blattner F.R. Infect. Immun. 71:2775-2786 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CD20 Antibody (MS4A1/6993R) [Alexa Fluor 350]
NBP3-24154AF350 0.1 mL

Rabbit Monoclonal CD20 Antibody (MS4A1/6993R) [Alexa Fluor 350]

Sign In for Pricing
View Details
Rat Monoclonal CXCL16 Antibody (RM0208-15Q2) [mFluor Violet 500 SE]
NBP2-12226MFV500 0.1 mL

Rat Monoclonal CXCL16 Antibody (RM0208-15Q2) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
SREK1 Polyclonal Antibody
RD81284A-01 60 μL

SREK1 Polyclonal Antibody

Sign In for Pricing
View Details
SREK1 Polyclonal Antibody
RD81284A-02 120 μL

SREK1 Polyclonal Antibody

Sign In for Pricing
View Details
SREK1 Polyclonal Antibody
RD81284A-03 200 µL

SREK1 Polyclonal Antibody

Sign In for Pricing
View Details
IL11RA Antibody
orb1256887 100 µL

IL11RA Antibody

Sign In for Pricing
View Details