Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pepsin A-5 (PGA5)

Product Specifications

Product Name Alternative

Pepsinogen-5

Abbreviation

Recombinant Human PGA5 protein

Gene Name

PGA5

UniProt

P0DJD9

Expression Region

63-388aa

Organism

Homo sapiens (Human)

Target Sequence

VDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNVPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Shows particularly broad specificity; although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Shows particularly broad specificity; although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent.

Molecular Weight

41.6 kDa

References & Citations

"Detection of pepsin in mouth swab: correlation with clinical gastroesophageal reflux in preterm infants." Farhath S., He Z., Saslow J., Soundar S., Amendolia B., Bhat V., Pyon K., Stahl G., Mehta D., Aghai Z.H. J. Matern. Fetal. Neonatal. Med. 26:819-824 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS6KA5 Protein Vector (Mouse) (pPB-C-His)
PV225718 500 ng

RPS6KA5 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
3- ((4-iodophenyl) amino) -5-phenylcyclohex-2-en-1-one
IPA35485 250 mg

3- ((4-iodophenyl) amino) -5-phenylcyclohex-2-en-1-one

Sign In for Pricing
View Details
1- (4-fluorophenyl) -1H-pyrazole-3-carboxylic acid
sc-332885A 1 g

1- (4-fluorophenyl) -1H-pyrazole-3-carboxylic acid

Sign In for Pricing
View Details
RPL12P35 siRNA Oligos set (Human)
40788171 3x 5 nmol

RPL12P35 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Rabbit Monoclonal Syndecan-1/CD138 Antibody (017)
NBP2-89899-50ul 50 µL

Rabbit Monoclonal Syndecan-1/CD138 Antibody (017)

Sign In for Pricing
View Details
Recombinant Human WWC1 Protein, N-His
bs-102231P-01 20 µg

Recombinant Human WWC1 Protein, N-His

Sign In for Pricing
View Details