Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pepsin A-5 (PGA5)

Product Specifications

Product Name Alternative

Pepsinogen-5

Abbreviation

Recombinant Human PGA5 protein

Gene Name

PGA5

UniProt

P0DJD9

Expression Region

63-388aa

Organism

Homo sapiens (Human)

Target Sequence

VDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNVPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Shows particularly broad specificity; although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Shows particularly broad specificity; although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent.

Molecular Weight

41.6 kDa

References & Citations

"Detection of pepsin in mouth swab: correlation with clinical gastroesophageal reflux in preterm infants." Farhath S., He Z., Saslow J., Soundar S., Amendolia B., Bhat V., Pyon K., Stahl G., Mehta D., Aghai Z.H. J. Matern. Fetal. Neonatal. Med. 26:819-824 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rsrc1 Mouse qPCR Primer Pair (NM_025822)
MP200875 200 Reactions

Rsrc1 Mouse qPCR Primer Pair (NM_025822)

Sign In for Pricing
View Details
Transferrin Receptor (CD71, TR, Tfr, TfnrR) (AP) discontinued
T8199-30B-AP 100 µL

Transferrin Receptor (CD71, TR, Tfr, TfnrR) (AP) discontinued

Sign In for Pricing
View Details
Mmu-miR-101a-3p miRNA Mimic
CMM0013-01 5 nmol

Mmu-miR-101a-3p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-101a-3p miRNA Mimic
CMM0013-02 10 nmol

Mmu-miR-101a-3p miRNA Mimic

Sign In for Pricing
View Details
SPAG7 shRNA (h) Lentiviral Particles
sc-93842-V 200 µL

SPAG7 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
General E1 ELISA Kit
OM625299 96 Strip Well

General E1 ELISA Kit

Sign In for Pricing
View Details