What is the catalog number for Recombinant Human Pepsin A-5 (PGA5)?

The catalog number for Recombinant Human Pepsin A-5 (PGA5) is CSB-EP320706HU.

What sizes are available for Recombinant Human Pepsin A-5 (PGA5)?

Recombinant Human Pepsin A-5 (PGA5) is available in the following size(s): 10 µg, 50 µg, 200 µg, 500 µg, 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human Pepsin A-5 (PGA5) come in?

Recombinant Human Pepsin A-5 (PGA5) is available in 7 different pack sizes.

Is Recombinant Human Pepsin A-5 (PGA5) in stock?

Recombinant Human Pepsin A-5 (PGA5) is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures Recombinant Human Pepsin A-5 (PGA5)?

Recombinant Human Pepsin A-5 (PGA5) is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Human Pepsin A-5 (PGA5)?

Estimated delivery time for Recombinant Human Pepsin A-5 (PGA5) is approximately 15 business day(s), depending on your location.

Recombinant Human Pepsin A-5 (PGA5)

Product Specifications

Product Name Alternative

Pepsinogen-5

Abbreviation

Recombinant Human PGA5 protein

Gene Name

PGA5

UniProt

P0DJD9

Expression Region

63-388aa

Organism

Homo sapiens (Human)

Target Sequence

VDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNVPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Shows particularly broad specificity; although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Shows particularly broad specificity; although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent.

Molecular Weight

41.6 kDa

References & Citations

"Detection of pepsin in mouth swab: correlation with clinical gastroesophageal reflux in preterm infants." Farhath S., He Z., Saslow J., Soundar S., Amendolia B., Bhat V., Pyon K., Stahl G., Mehta D., Aghai Z.H. J. Matern. Fetal. Neonatal. Med. 26:819-824 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.