Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse von Willebrand factor (Vwf), partial

Product Specifications

Product Name Alternative

Von Willebrand antigen II (vWF)

Abbreviation

Recombinant Mouse Vwf protein, partial

Gene Name

Vwf

UniProt

Q8CIZ8

Expression Region

1498-1665aa

Organism

Mus musculus (Mouse)

Target Sequence

DVVFVLEGSDEVGEANFNKSKEFVEEVIQRMDVSPDATRISVLQYSYTVTMEYAFNGAQSKEEVLRHVREIRYQGGNRTNTGQALQYLSEHSFSPSQGDRVEAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPHANMQELERISRPIAPIFIRDFETLPREAPDLV

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cancer

Relevance

Important in the maintenance of hemostasis, it promotes adhesion of platelets to the sites of vascular injury by forming a molecular bridge between sub-endothelial collagen matrix and platelet-surface receptor complex GPIb-IX-V. Also acts as a chaperone for coagulation factor VIII, delivering it to the site of injury, stabilizing its heterodimeric structure and protecting it from premature clearance from plasma.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Important in the maintenance of hemostasis, it promotes adhesion of platelets to the sites of vascular injury by forming a molecular bridge between sub-endothelial collagen matrix and platelet-surface receptor complex GPIb-IX-V. Also acts as a chaperone for coagulation factor VIII, delivering it to the site of injury, stabilizing its heterodimeric structure and protecting it from premature clearance from plasma.

Molecular Weight

22.3 kDa

References & Citations

"A tissue-specific atlas of mouse protein phosphorylation and expression." Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P. Cell 143:1174-1189 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Endometrium
CS806238 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
Recombinant PSGL1 Antibody
RC-15711-01 50 μL

Recombinant PSGL1 Antibody

Sign In for Pricing
View Details
Recombinant PSGL1 Antibody
RC-15711-02 100 µL

Recombinant PSGL1 Antibody

Sign In for Pricing
View Details
Recombinant PSGL1 Antibody
RC-15711-03 1 mL

Recombinant PSGL1 Antibody

Sign In for Pricing
View Details
UPRT Mouse Monoclonal Antibody [Clone ID: OTI1D12]
CF809847 100 µg

UPRT Mouse Monoclonal Antibody [Clone ID: OTI1D12]

Sign In for Pricing
View Details
CRALBP (RLBP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A5]
TA503149AM 100 µL

CRALBP (RLBP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A5]

Sign In for Pricing
View Details