Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Paracoccus denitrificans Electron transfer flavoprotein-ubiquinone oxidoreductase

Product Specifications

Product Name Alternative

Electron-transferring-flavoprotein dehydrogenase (ETF dehydrogenase) (ETF-QO) (ETF-ubiquinone oxidoreductase)

Abbreviation

Recombinant Paracoccus denitrificans ETF-ubiquinone oxidoreductase protein

UniProt

P55932

Expression Region

1-31aa

Organism

Paracoccus denitrificans

Target Sequence

SDIGGSMDYDVVIVGAGGAGLSAAILKQVNP

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Accepts electrons from ETF and reduces ubiquinone.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Accepts electrons from ETF and reduces ubiquinone.

Molecular Weight

18.4 kDa

References & Citations

"Molecular cloning and expression of a cDNA encoding human electron transfer flavoprotein-ubiquinone oxidoreductase." Goodman S.I., Axtell K.M., Bindoff L.A., Beard S.E., Gill R.E., Frerman F.E. Eur. J. Biochem. 219:277-286 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL
BNC400181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL
BNC400003-100 1x 100 µL

CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-500 1x 500 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD15 / FUT4 (Reed-Sternberg Cell Marker) (FUT4/1478R), CF568 conjugate, 0.1mg/mL
BNC681478-100 1x 100 µL

CD15 / FUT4 (Reed-Sternberg Cell Marker) (FUT4/1478R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (1415-1), CF647 conjugate, 0.1mg/mL
BNC470580-500 1x 500 µL

Histone H1 (1415-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details