Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trypanosoma cruzi Kinetoplastid membrane protein 11 (KMP-11)

Product Specifications

Product Name Alternative

KMP11

Abbreviation

Recombinant Trypanosoma cruzi KMP-11 protein

Gene Name

KMP-11

UniProt

Q9U6Z1

Expression Region

1-92aa

Organism

Trypanosoma cruzi

Target Sequence

MATTLEEFSAKLDRLDAEFAKKMEEQNKKFFADKPDESTLSPEMKEHYEKFEKMIQEHTDKFNKKMHEHSEHFKAKFAELLEQQKNAQFPGK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Microbiology

Relevance

May be involved in the regulation of the cytoskeleton through interaction with the subpellicular microtubules. May be involved in parasite mobility and attachment to the surface of the host cell. Behaves as a strong immunogen during infection.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be involved in the regulation of the cytoskeleton through interaction with the subpellicular microtubules. May be involved in parasite mobility and attachment to the surface of the host cell. Behaves as a strong immunogen during infection.

Molecular Weight

18.0 kDa

References & Citations

"Mapping of the antigenic determinants of the T. cruzi kinetoplastid membrane protein-11. Identification of a linear epitope specifically recognized by human Chagasic sera." Thomas M.C., Longobardo M.V., Carmelo E., Maranon C., Planelles L., Patarroyo M.E., Alonso C., Lopez M.C. Clin. Exp. Immunol. 123:465-471 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zombie Yellow™ Fixable Viability Kit
GT18003 100 Tests

Zombie Yellow™ Fixable Viability Kit

Sign In for Pricing
View Details
4EBP1 antibody (Thr69)
70R-30845 100 ug

4EBP1 antibody (Thr69)

Sign In for Pricing
View Details
T-3775440 hydrochloride 5mg
A18340-5 5 mg

T-3775440 hydrochloride 5mg

Sign In for Pricing
View Details
Zfp474 Protein Vector (Mouse) (pPM-C-HA)
PV249592 500 ng

Zfp474 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Human MMP13 ELISA kit
55R-1657 1 kit

Human MMP13 ELISA kit

Sign In for Pricing
View Details
Lentiviral mouse Pld3 shRNA (UAS) - Lentiviral mouse Pld3 shRNA (UAS, GFP) (100)
GTR15200133 1 Vial

Lentiviral mouse Pld3 shRNA (UAS) - Lentiviral mouse Pld3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details